DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ndl and CG4613

DIOPT Version :9

Sequence 1:NP_523947.2 Gene:ndl / 38738 FlyBaseID:FBgn0002926 Length:2616 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:268 Identity:99/268 - (36%)
Similarity:144/268 - (53%) Gaps:34/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1128 RVRRAVSDSKEIVGDGRIVGGSYTSALQWPFVVAIYRNGKFHCGGTIYSDRWIISAAHCVINYGK 1192
            ||.|..|.:..:....|||||:.....::|::..|.|.....||||:.:||::::|||||  :|.
  Fly   120 RVNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCV--HGM 182

  Fly  1193 YFYEVRAGLL---RRSSYSPATQIQPVSHVVVHQAYERRSMRNDLSLLRLLNPLQFNRWVKPICL 1254
            ....|...||   |.|::...|:....:|  .|..|:..|:.:|::||||..|:.....::|.||
  Fly   183 DMRGVSVRLLQLDRSSTHLGVTRSVAFAH--AHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL 245

  Fly  1255 PDKGRTTVGDDWIWGPVEHTLCTVVGWGAIREKGPSSDPMRQVIVPIRKKCTDPEDQASE----- 1314
            |        .:|:.. .:.....|.|||..:|.|.:|..:::|:|||   .|:.:.:|:.     
  Fly   246 P--------SNWLQN-FDFQKAIVAGWGLSQEGGSTSSVLQEVVVPI---ITNAQCRATSYRSMI 298

  Fly  1315 ---DICAG-DPDGGRDACQGDSGGPLFCRSVSNPDE-FYLAGVVSHGNGCARPQEFGVYTRVTLY 1374
               .:||| ...||||||||||||||..|     |. |.||||||.|.|||:|...||||||:.|
  Fly   299 VDTMMCAGYVKTGGRDACQGDSGGPLIVR-----DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRY 358

  Fly  1375 LDWLEMAT 1382
            |:|:.:.|
  Fly   359 LEWIAVNT 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ndlNP_523947.2 LDLa 891..927 CDD:238060
Tryp_SPc 1144..1377 CDD:214473 93/245 (38%)
Tryp_SPc 1145..1379 CDD:238113 93/246 (38%)
LDLa 1399..1430 CDD:238060
Metaviral_G 1448..1600 CDD:118131
LDLa 1710..1743 CDD:238060
LDLa 1776..1811 CDD:238060
DUF1986 2041..2158 CDD:286432
LDLa 2309..2339 CDD:197566
LDLa 2350..2383 CDD:197566
LDLa 2421..2457 CDD:238060
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 93/246 (38%)
Tryp_SPc 137..362 CDD:238113 92/245 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.