DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ndl and CG9294

DIOPT Version :9

Sequence 1:NP_523947.2 Gene:ndl / 38738 FlyBaseID:FBgn0002926 Length:2616 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:251 Identity:99/251 - (39%)
Similarity:137/251 - (54%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1144 RIVGGSYTSALQWPFVVAIYRNGKFHCGGTIYSDRWIISAAHCVINYGKYFYEVRAGLLRRSSYS 1208
            :||||..|...|:|::..|....:|:|.|::.:|.::::|||||.........:|.....||..:
  Fly   100 KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSN 164

  Fly  1209 PATQIQP-VSHVVVHQAYERRSMRNDLSLLRLLNPLQF-NRWVKPICLPDKGRTTVGDDWIWGPV 1271
            ....||. ||.|.||:.|..||..|||::|||..||.. :..::|||||.:..:          .
  Fly   165 DDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYS----------F 219

  Fly  1272 EHTLCTVVGWGAIREKGPSSDPMRQVIVPI--RKKCTD-----PEDQASEDICAG-DPDGGRDAC 1328
            :|.|..|.||||.||.|..:|.:|:|.|.:  :.:|.:     |.......:||| ..:||:|||
  Fly   220 DHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDAC 284

  Fly  1329 QGDSGGPLFCRSVSNPDEFYLAGVVSHGNGCARPQEFGVYTRVTLYLDWLEMATTP 1384
            .|||||||.......|.::.|||:||.|.||||||..||||||..||.||. :.||
  Fly   285 SGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLG-SNTP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ndlNP_523947.2 LDLa 891..927 CDD:238060
Tryp_SPc 1144..1377 CDD:214473 95/242 (39%)
Tryp_SPc 1145..1379 CDD:238113 96/243 (40%)
LDLa 1399..1430 CDD:238060
Metaviral_G 1448..1600 CDD:118131
LDLa 1710..1743 CDD:238060
LDLa 1776..1811 CDD:238060
DUF1986 2041..2158 CDD:286432
LDLa 2309..2339 CDD:197566
LDLa 2350..2383 CDD:197566
LDLa 2421..2457 CDD:238060
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 95/242 (39%)
Tryp_SPc 101..334 CDD:238113 95/242 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.