DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ndl and Tmprss11b

DIOPT Version :9

Sequence 1:NP_523947.2 Gene:ndl / 38738 FlyBaseID:FBgn0002926 Length:2616 Species:Drosophila melanogaster
Sequence 2:NP_001004020.1 Gene:Tmprss11b / 365265 RGDID:1303278 Length:420 Species:Rattus norvegicus


Alignment Length:272 Identity:80/272 - (29%)
Similarity:133/272 - (48%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1135 DSKEIVGD------------GRIVGGSYTSALQWPFVVAIYRNGKFHCGGTIYSDRWIISAAHCV 1187
            |:::|:.:            .||.|||.....:||:..::..|||.|||.::..:|::::||||.
  Rat   167 DAEKIINNRCGRRPRMSATYDRITGGSTAQKGEWPWQASLRVNGKHHCGASLIGERFLLTAAHCF 231

  Fly  1188 INYGKYFYEVRAGLLRRSSYSPATQIQP------VSHVVVHQAYERRSMRNDLSLLRLLNPLQFN 1246
            :         |....:..:.|..|::.|      |..|::|:.|.:....:|:::::|...:.|.
  Rat   232 L---------RTNNPKNLTVSFGTRVTPAYMQHYVEEVIIHEDYVKGQHHDDVAIIKLTEKVSFR 287

  Fly  1247 RWVKPICLPDKGRTTVGDDWIWGPVEHTLCTVVGWGAIREKGPSSDPMRQVIVPI--RKKCTDPE 1309
            ..|..:|||:..:       ::.|.|..:  |.|||::...|.|...:::..:.|  ...|...|
  Rat   288 NDVHRVCLPEATQ-------VFPPGEGVV--VTGWGSLSYNGKSPLLLQKASIKIIDTNACNSEE 343

  Fly  1310 DQASE----DICAGDPDGGRDACQGDSGGPLFCRSVSNPDEFYLAGVVSHGNGCARPQEFGVYTR 1370
            .....    .:|||..:|..|||||||||||.  ..::.|.:||.|:||.|:.|.|..:.|||.|
  Rat   344 AYGGRIMDTMLCAGYMEGYVDACQGDSGGPLV--HPNSRDIWYLVGIVSWGHECGRVNKPGVYMR 406

  Fly  1371 VTLYLDWLEMAT 1382
            ||.|.||:...|
  Rat   407 VTSYRDWIASKT 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ndlNP_523947.2 LDLa 891..927 CDD:238060
Tryp_SPc 1144..1377 CDD:214473 75/244 (31%)
Tryp_SPc 1145..1379 CDD:238113 76/245 (31%)
LDLa 1399..1430 CDD:238060
Metaviral_G 1448..1600 CDD:118131
LDLa 1710..1743 CDD:238060
LDLa 1776..1811 CDD:238060
DUF1986 2041..2158 CDD:286432
LDLa 2309..2339 CDD:197566
LDLa 2350..2383 CDD:197566
LDLa 2421..2457 CDD:238060
Tmprss11bNP_001004020.1 SEA 50..144 CDD:279699
Tryp_SPc 188..414 CDD:214473 76/245 (31%)
Tryp_SPc 189..417 CDD:238113 76/247 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.