DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ndl and Tmprss11g

DIOPT Version :9

Sequence 1:NP_523947.2 Gene:ndl / 38738 FlyBaseID:FBgn0002926 Length:2616 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:340 Identity:88/340 - (25%)
Similarity:159/340 - (46%) Gaps:66/340 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 DENSRMDHSASLNVSFQTLTLPGPFIEPSLHAGVHFAQACHGRNSHDSLVDHVAYVKCPPMQCGL 1116
            :.:|.::.....:.||....:..|::..     ::.|||.|..||:                |||
  Rat   133 EADSILNKKLQSSQSFLKRDISLPYLRE-----MNAAQAEHILNSN----------------CGL 176

  Fly  1117 PSKSSMLEHSKRVRRAVSDSKEIVGDGRIVGGSYTSALQWPFVVAIYRNGKFHCGGTIYSDRWII 1181
            .     :|:.:..|         :.||:..|.:     .||:..::...|...||.::...:|::
  Rat   177 G-----MEYPRIAR---------IADGKPAGSN-----SWPWQSSLQVEGIHLCGASLIGSQWLV 222

  Fly  1182 SAAHCVINY-GKYFYEVRAGLLRRSSYSPATQIQPVSHVVVHQAYERRSMRNDLSLLRLLNPLQF 1245
            ::|||..|| ....:.|..|   |:..:|.| .:.|..:::|:.|......:|:::::|.:|:.|
  Rat   223 TSAHCFDNYKNPKLWTVSFG---RTLGNPLT-TRKVESIIIHENYAAHKHDDDIAVVKLSSPVLF 283

  Fly  1246 NRWVKPICLPDKGRTTVGDDWIWGPVEHTLCTVVGWGAIREKGPSSDPMRQVIVPIRKKCTDPED 1310
            :..::.:|||:.....:....::         |.||||::..||..:.:::|.:.|..  .|..:
  Rat   284 SENLRTVCLPEATFQVLPKSKVF---------VTGWGALKANGPFPNSLQEVEIEIIS--NDVCN 337

  Fly  1311 Q--------ASEDICAGDPDGGRDACQGDSGGPLFCRSVSNPDEFYLAGVVSHGNGCARPQEFGV 1367
            |        :|..||||...|..|||:|||||||...  .|.:::||.|:||.|..|.:..:.|:
  Rat   338 QVNVYGGAISSGMICAGFLTGKLDACEGDSGGPLVIS--DNRNKWYLLGIVSWGIDCGKENKPGI 400

  Fly  1368 YTRVTLYLDWLEMAT 1382
            |||||.|.:|::..|
  Rat   401 YTRVTHYRNWIKSKT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ndlNP_523947.2 LDLa 891..927 CDD:238060
Tryp_SPc 1144..1377 CDD:214473 69/241 (29%)
Tryp_SPc 1145..1379 CDD:238113 70/242 (29%)
LDLa 1399..1430 CDD:238060
Metaviral_G 1448..1600 CDD:118131
LDLa 1710..1743 CDD:238060
LDLa 1776..1811 CDD:238060
DUF1986 2041..2158 CDD:286432
LDLa 2309..2339 CDD:197566
LDLa 2350..2383 CDD:197566
LDLa 2421..2457 CDD:238060
Tmprss11gNP_001008554.1 SEA 48..142 CDD:279699 1/8 (13%)
Tryp_SPc 185..411 CDD:214473 72/256 (28%)
Tryp_SPc 186..414 CDD:238113 72/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.