DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ndl and zgc:163079

DIOPT Version :9

Sequence 1:NP_523947.2 Gene:ndl / 38738 FlyBaseID:FBgn0002926 Length:2616 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:271 Identity:70/271 - (25%)
Similarity:120/271 - (44%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1144 RIVGGSYTSALQWPFVVAIYRNG--KFHCGGTIYSDRWIISAAHCVINYGKYFYEVRAGLLRRSS 1206
            :|:||...:...||:..:|....  :|:|||::.:..|:::.|............|..|...::.
Zfish    35 KIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGRQTQNG 99

  Fly  1207 YSPATQIQPVSHVVVHQAYERRSMRNDLSLLRLLNPLQFNRWVKPICLPDKGRTTVGDDWIWGPV 1271
            .:|....:.|:.::.|..|  .|:.::|:||:|.:|:.|:.::||:||...|...|.....|   
Zfish   100 SNPYEISRTVTKIIKHPNY--NSLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFVDGTASW--- 159

  Fly  1272 EHTLCTVVGWGAIREKGPSS-------DPMRQVIVPI--RKKCTDPEDQ--ASEDICAGD-PDGG 1324
                  |.|||.:..  |::       |.:::|..||  ..:|......  .::.:|||. .:.|
Zfish   160 ------VTGWGYLNR--PATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKLLCAGYLNEDG 216

  Fly  1325 RDACQGDSGGPLFCRSVSNPDEFYLAGVVSHGNGCARPQEFGVYTRVTLYLDWLEMATTPRLLPK 1389
            :..|.||.||||.   :.....:..:|||..|. |..|....:|.||:.|.||:...|...|   
Zfish   217 KAPCAGDVGGPLV---IKQGAIWIQSGVVVSGY-CGLPGYPTIYVRVSEYEDWISYYTNSSL--- 274

  Fly  1390 LQPLQLCPGFI 1400
                   |||:
Zfish   275 -------PGFV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ndlNP_523947.2 LDLa 891..927 CDD:238060
Tryp_SPc 1144..1377 CDD:214473 63/246 (26%)
Tryp_SPc 1145..1379 CDD:238113 65/247 (26%)
LDLa 1399..1430 CDD:238060 1/2 (50%)
Metaviral_G 1448..1600 CDD:118131
LDLa 1710..1743 CDD:238060
LDLa 1776..1811 CDD:238060
DUF1986 2041..2158 CDD:286432
LDLa 2309..2339 CDD:197566
LDLa 2350..2383 CDD:197566
LDLa 2421..2457 CDD:238060
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 64/247 (26%)
Tryp_SPc 36..267 CDD:238113 65/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.