DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and HS3ST4

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_006031.2 Gene:HS3ST4 / 9951 HGNCID:5200 Length:456 Species:Homo sapiens


Alignment Length:272 Identity:83/272 - (30%)
Similarity:129/272 - (47%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 LPKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWYMDFFPSESLP 822
            ||:.|:||.:|.||.||...:.:|..:.:....|..|:       .||.:||:||.:.       
Human   197 LPQALIIGVKKGGTRALLEAIRVHPDVRAVGVEPHFFD-------RNYEKGLEWYRNV------- 247

  Fly   823 NTSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHG- 886
                 ||..|.. :...||:.:||.....|||.|::....|::.::.:|..||.|.|....|.. 
Human   248 -----MPKTLDG-QITMEKTPSYFVTNEAPKRIHSMAKDIKLIVVVRNPVTRAISDYTQTLSKKP 306

  Fly   887 -----DVIANNYSFYQVITASDSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQQLHIIDGEQL 946
                 :|:|.......:|.||.||.|.           |.||.|||:||.|:|..|:..:.||:|
Human   307 EIPTFEVLAFKNRTLGLIDASWSAIRI-----------GIYALHLENWLQYFPLSQILFVSGERL 360

  Fly   947 RLNPIDVMNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSEKRN--KCLGKSKGRQYPAMDERS 1009
            .::|...|.::|.||.::.::. ..|..::..|||.|....|..:  :||||||||.:|.:|...
Human   361 IVDPAGEMAKVQDFLGLKRVVT-EKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRIDPDV 424

  Fly  1010 AKLLQRYYLNHN 1021
            ...|:::|...|
Human   425 IHRLRKFYKPFN 436

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 81/266 (30%)
HS3ST4NP_006031.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..192
Sulfotransfer_1 197..434 CDD:279075 82/268 (31%)
Substrate binding. /evidence=ECO:0000250 229..235 2/12 (17%)
Substrate binding. /evidence=ECO:0000250 260..263 1/2 (50%)