DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and si:dkey-121b10.7

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:XP_001337988.1 Gene:si:dkey-121b10.7 / 797517 ZFINID:ZDB-GENE-090312-176 Length:361 Species:Danio rerio


Alignment Length:265 Identity:78/265 - (29%)
Similarity:121/265 - (45%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   759 PKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWYMDFFPSESLPN 823
            |:.::||.:|.||.||..||.:|..:.:..|.|..|:..       |.:||.||.:.        
Zfish   109 PQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRF-------YDKGLQWYRNL-------- 158

  Fly   824 TSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHGDV 888
                ||..|.. :...||:.:||.....|.|..::....|::.::..|..||.|.|....|....
Zfish   159 ----MPRSLDG-QITMEKTPSYFITHEAPARVFSMSRGTKLIVVVRDPVTRAVSDYTQTLSKNPG 218

  Fly   889 IANNYSFYQVITASDSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQQLHIIDGEQLRLNPIDV 953
            :.   ||..::..:.|.  .|.|.....:..|.||:|||:||.|:|..|...:.||:|..:|...
Zfish   219 LP---SFQSLVFKNSST--GLIDTSWSAVRIGIYAKHLENWLRYFPLAQFLFVSGERLVTDPAGE 278

  Fly   954 MNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSE--KRNKCLGKSKGRQYPAMDERSAKLLQRY 1016
            |..:|.||.::.::. :.|..::..|||.|....|  .|.:||||||||.:|.:.......|:.:
Zfish   279 MGRVQDFLGLKRVVS-NKHFYFNQTKGFPCLKKPEGSSRPRCLGKSKGRAHPQIPPDVLHRLRDF 342

  Fly  1017 YLNHN 1021
            |...|
Zfish   343 YRPFN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 76/259 (29%)
si:dkey-121b10.7XP_001337988.1 Sulfotransfer_1 109..349 CDD:279075 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.