DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and hs3st3b1a

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_001074038.1 Gene:hs3st3b1a / 767708 ZFINID:ZDB-GENE-070202-4 Length:366 Species:Danio rerio


Alignment Length:266 Identity:83/266 - (31%)
Similarity:130/266 - (48%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 LPKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWYMDFFPSESLP 822
            ||:.::||.:|.||.||..||.:|..|.:..|.|..|:       .||.:||:||.:.       
Zfish   113 LPQAIIIGVKKGGTRALLEFLRLHPDIRAVGAEPHFFD-------RNYEKGLEWYREL------- 163

  Fly   823 NTSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHGD 887
                 ||..|.. :...||:.:||..:.||.|.||:....|::.::..|..||.|.|...||...
Zfish   164 -----MPKTLDG-QLTMEKTPSYFVTKEVPGRIHAMSRDTKLIVVVRDPVTRAISDYTQTRSKKP 222

  Fly   888 VIANNYSFYQVITASDSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQQLHIIDGEQLRLNPID 952
            .|.:    ::.:|..:.:...: |.....:..|.||:|||.||.::|..||..:.||:|..:|..
Zfish   223 DIPS----FESLTFKNLSTNVI-DTSWSAVQIGMYARHLERWLQFFPMSQLLFVSGERLISDPSG 282

  Fly   953 VMNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSEKRNK--CLGKSKGRQYPAMDERSAKLLQR 1015
            .|..:|.||.::..:.: .|..::..|||.|....|..||  ||||:|||.:|.::....:.|:.
Zfish   283 EMARVQHFLGLRREVTH-KHFHFNPAKGFPCLKRPESNNKPHCLGKTKGRTHPNINPEVIQRLRD 346

  Fly  1016 YYLNHN 1021
            :|...|
Zfish   347 FYKPFN 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 81/260 (31%)
hs3st3b1aNP_001074038.1 Sulfotransfer_1 113..350 CDD:279075 82/262 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.