DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and Hs3st4

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_001239001.1 Gene:Hs3st4 / 628779 MGIID:1333792 Length:449 Species:Mus musculus


Alignment Length:272 Identity:83/272 - (30%)
Similarity:129/272 - (47%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 LPKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWYMDFFPSESLP 822
            ||:.|:||.:|.||.||...:.:|..:.:....|..|:       .||.:||:||.:.       
Mouse   190 LPQALIIGVKKGGTRALLEAIRVHPDVRAVGVEPHFFD-------RNYEKGLEWYRNV------- 240

  Fly   823 NTSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHG- 886
                 ||..|.. :...||:.:||.....|||.|::....|::.::.:|..||.|.|....|.. 
Mouse   241 -----MPKTLDG-QITMEKTPSYFVTNEAPKRIHSMAKDIKLIVVVRNPVTRAISDYTQTLSKKP 299

  Fly   887 -----DVIANNYSFYQVITASDSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQQLHIIDGEQL 946
                 :|:|.......:|.||.||.|.           |.||.|||:||.|:|..|:..:.||:|
Mouse   300 EIPTFEVLAFKNRTLGLIDASWSAIRI-----------GIYALHLENWLQYFPLSQILFVSGERL 353

  Fly   947 RLNPIDVMNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSEKRN--KCLGKSKGRQYPAMDERS 1009
            .::|...|.::|.||.::.::. ..|..::..|||.|....|..:  :||||||||.:|.:|...
Mouse   354 IVDPAGEMAKVQDFLGLKRVVT-EKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRIDPDV 417

  Fly  1010 AKLLQRYYLNHN 1021
            ...|:::|...|
Mouse   418 IHRLRKFYKPFN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 81/266 (30%)
Hs3st4NP_001239001.1 Sulfotransfer_1 190..427 CDD:279075 82/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847486
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.