DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and hs3st4

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_001074058.2 Gene:hs3st4 / 563570 ZFINID:ZDB-GENE-070202-8 Length:422 Species:Danio rerio


Alignment Length:304 Identity:91/304 - (29%)
Similarity:141/304 - (46%) Gaps:54/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   754 NCDS------LPKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWY 812
            ||.|      ||:.::||.:|.||.||...|.:|..:.:....|..|:       .||.:|||||
Zfish   147 NCTSDYGEKKLPQAIIIGVKKGGTRALLEALRVHPDVRAVGNEPHFFD-------RNYEKGLDWY 204

  Fly   813 MDFFPSESLPNTSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYS 877
            .:..||           |..|  :...||:.:||...:.|||.|.:....|::.::.:|..||.|
Zfish   205 RELMPS-----------TLEG--QITMEKTPSYFVTNSAPKRIHTMARDIKLIIVVRNPVTRAIS 256

  Fly   878 WYQHQRSHG------DVIANNYSFYQVITASDSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQ 936
            .|....|..      :|:|.......:|.||.||           |..|.||.|||.|:.|:|..
Zfish   257 DYTQTLSKRPEIPTFEVLAFKNRTLGLIDASWSA-----------LRIGIYALHLESWMQYFPLS 310

  Fly   937 QLHIIDGEQLRLNPIDVMNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSEKRN--KCLGKSKG 999
            |:|.:.||:|.::|...|.::|.||.::.::. ..|..::..|||.|....|..:  :|||||||
Zfish   311 QMHFVSGERLIVDPAGEMAKVQDFLGLKRIVT-DKHFYFNKTKGFPCLKKPEDSSTPRCLGKSKG 374

  Fly  1000 RQYPAMDERSAKLLQRYYLNHNTALVKL--------LKKLGSRP 1035
            |.:|.:|....:.|.::|...|....::        |::.|:.|
Zfish   375 RTHPKIDPDVIRRLHKFYKPFNMMFYQMTGQNFQWELEEDGNSP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 83/266 (31%)
hs3st4NP_001074058.2 Sulfotransfer_1 157..394 CDD:279075 84/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592772
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.