DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and hs3st1l2

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_001035015.1 Gene:hs3st1l2 / 562344 ZFINID:ZDB-GENE-070202-3 Length:303 Species:Danio rerio


Alignment Length:280 Identity:86/280 - (30%)
Similarity:132/280 - (47%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 SKTKNCDSLPKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFN-GNNYYRGLDWYM 813
            |.......||..::||.:|.||.||...|::|..:  .:|.    .|:.:|| ..|:.:||||| 
Zfish    42 SNASTLQRLPGAIIIGVRKGGTRALLEMLNLHPDV--EVAK----TEIHYFNLDENFRKGLDWY- 99

  Fly   814 DFFPSESLPNTSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSW 878
                ...:|.|   :|.||     ..||:..||.....|:|..|:.|..|::.|:..||:|..|.
Zfish   100 ----RSQMPIT---LPGQL-----TVEKTPGYFTAPPAPRRIWAMNPAVKLLLIIRDPAERLVSD 152

  Fly   879 YQ---HQRSHGDVIANNYSFYQVITASDSAPRALKDL---------RNRCLNPGKYAQHLEHWLA 931
            |.   |.|     |..|..:           ::|::|         :.:.|....|.|||..||.
Zfish   153 YTQVLHNR-----IQQNKPY-----------QSLEELLLSQGHINPKYKALQRSFYYQHLARWLE 201

  Fly   932 YYPAQQLHIIDGEQLRLNPIDVMNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSEKRNKCLGK 996
            .:|.:|:||:|||.|..||...:.:.:.||::.|.:...| ..::|.|||||. :|...:|||.:
Zfish   202 LFPREQIHIVDGEALIRNPFPELQKAETFLELPPQIKPDN-FYFNVTKGFYCM-LSAGHDKCLDE 264

  Fly   997 SKGRQYPAMDERSAKLLQRY 1016
            ||||.:..:...:.:.|.||
Zfish   265 SKGRPHAPLSNEAFQKLCRY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 85/272 (31%)
hs3st1l2NP_001035015.1 Sulfotransfer_1 54..285 CDD:279075 83/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.