DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and hs3st3b1b

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_001074037.1 Gene:hs3st3b1b / 558084 ZFINID:ZDB-GENE-070202-5 Length:396 Species:Danio rerio


Alignment Length:323 Identity:93/323 - (28%)
Similarity:144/323 - (44%) Gaps:38/323 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 WTNLKL-ASAPPVQLAEMYFRLHPEEVDPV--WGNPCDDVRHKKIWSKTKN---CDSLPKFLVIG 765
            ||:::. ...|.|:.|...|.....:.|..  |    ||.|.....|...|   ...||:.::||
Zfish    90 WTDVESDYDEPAVRRALRDFSKDEGDADRAEEW----DDGRRVSALSTFSNGSGSKKLPQAIIIG 150

  Fly   766 PQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWYMDFFPSESLPNTSSPMPT 830
            .:|.||.||..||.:|..|.:..|.|..|:       .||..|||||.|..|.           |
Zfish   151 VKKGGTRALLEFLRVHPDIRAVGAEPHFFD-------RNYENGLDWYRDLMPK-----------T 197

  Fly   831 QLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHGDVIANNYSF 895
            ..|  :...||:.:||.....|.|.:|:....|::.::..|..||.|.|....|....|..    
Zfish   198 LEG--QITMEKTPSYFVTREAPSRIYAMSRDTKLIVVVRDPVTRAISDYTQTLSKKPDIPT---- 256

  Fly   896 YQVITASDSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQQLHIIDGEQLRLNPIDVMNELQRF 960
            ::.:|..:.. ..|.|.....:..|.||:||::||.::|..|:..:.||:|..:|...:..:|.|
Zfish   257 FESLTFKNRT-TGLIDTSWSAIQIGIYAKHLDNWLQFFPMSQILFVSGERLISDPAGELGRVQDF 320

  Fly   961 LKIQPLLDYSNHLRYDVKKGFYCQAVSEKRNK--CLGKSKGRQYPAMDERSAKLLQRYYLNHN 1021
            |.::.::. ..|..::..|||.|...:|..:|  ||||:|||.:|.:|....:.|:.:|...|
Zfish   321 LGLKRIIT-DKHFYFNQTKGFPCLKKAEGSSKPHCLGKTKGRTHPNIDPEVVQRLRDFYRPFN 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 78/260 (30%)
hs3st3b1bNP_001074037.1 Sulfotransfer_1 143..384 CDD:279075 80/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.