DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and Hs3st3b1

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_001178575.1 Gene:Hs3st3b1 / 303218 RGDID:1307326 Length:390 Species:Rattus norvegicus


Alignment Length:266 Identity:80/266 - (30%)
Similarity:124/266 - (46%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 LPKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWYMDFFPSESLP 822
            ||:.::||.:|.||.||..||.:|..:.:..|.|..|:       .:|::||.||.|.       
  Rat   137 LPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFD-------RSYHKGLAWYRDL------- 187

  Fly   823 NTSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHGD 887
                 ||..| ..:...||:.:||.....|.|..|:....|::.::..|..||.|.|....|...
  Rat   188 -----MPRTL-EGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRP 246

  Fly   888 VIANNYSFYQVITASDSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQQLHIIDGEQLRLNPID 952
            .|.   ||..:...:.||  .|.|.....:..|.||:|||.||.::|..|:..:.||:|..:|..
  Rat   247 DIP---SFESLTFRNRSA--GLIDTSWSAIQIGLYAKHLEPWLRHFPLGQMLFVSGERLVSDPAG 306

  Fly   953 VMNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSEKRNK--CLGKSKGRQYPAMDERSAKLLQR 1015
            .:..:|.||.::.::. ..|..::..|||.|...:|...|  ||||:|||.:|.:.....:.|:.
  Rat   307 ELRRVQDFLGLKRIIT-DKHFYFNQTKGFPCLKKAEGSGKPHCLGKTKGRAHPTIAREVLRQLRD 370

  Fly  1016 YYLNHN 1021
            :|...|
  Rat   371 FYRPFN 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 78/260 (30%)
Hs3st3b1NP_001178575.1 Sulfotransfer_1 137..374 CDD:279075 79/262 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.