DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and Hs3st5

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_001099862.1 Gene:Hs3st5 / 294449 RGDID:1306379 Length:346 Species:Rattus norvegicus


Alignment Length:261 Identity:77/261 - (29%)
Similarity:129/261 - (49%) Gaps:23/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 LPKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFF-NGNNYYRGLDWYMDFFPSESL 821
            |||.::||.:|.||.||...|::|.::.      :..:|:.|| |..||.:|::||....|..  
  Rat    90 LPKAIIIGVRKGGTRALLEMLNLHPAVV------KASQEIHFFDNDENYAKGIEWYRKKMPFS-- 146

  Fly   822 PNTSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHG 886
                  .|.|:     ..|||..||..|.||:|.:.:....|::.|:..|..||.|.|.......
  Rat   147 ------YPQQI-----TIEKSPAYFITEEVPERIYKMNSSIKLLMIVREPTTRAISDYTQVLEGK 200

  Fly   887 DVIANNYSFYQVITASDSAPRALKDLRNRCLNPGKYAQHLEHWLAYYPAQQLHIIDGEQLRLNPI 951
            :  ..|.::|:....:........:.:.:.:....|.:|||.||.|:|.:|.||:||::|...|:
  Rat   201 E--RKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHIVDGDRLITEPL 263

  Fly   952 DVMNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSEKRNKCLGKSKGRQYPAMDERSAKLLQRY 1016
            ..:..:::||.:.|.:...| |.::..:||||...:...||||..||||.:|.:|......|:::
  Rat   264 PELQLVEKFLNLPPRISQYN-LYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVVTKLRKF 327

  Fly  1017 Y 1017
            :
  Rat   328 F 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 77/259 (30%)
Hs3st5NP_001099862.1 Sulfotransfer_1 90..330 CDD:279075 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.