DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sfl and hst-3.1

DIOPT Version :9

Sequence 1:NP_001163354.1 Gene:sfl / 38736 FlyBaseID:FBgn0020251 Length:1048 Species:Drosophila melanogaster
Sequence 2:NP_495230.2 Gene:hst-3.1 / 185573 WormBaseID:WBGene00002030 Length:307 Species:Caenorhabditis elegans


Alignment Length:285 Identity:73/285 - (25%)
Similarity:124/285 - (43%) Gaps:46/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   759 PKFLVIGPQKTGTTALYTFLSMHGSIASNIASPETFEEVQFFNGNNYYRGLDWYMDFFPSESLPN 823
            |..|::|.:|.||.||...:::|..:  .|...||    .||: :||..|.|||.|..|.....|
 Worm    51 PSALIVGVRKGGTRALLDAIALHPKV--RIVRRET----HFFD-SNYTLGFDWYRDQMPEVENDN 108

  Fly   824 TSSPMPTQLGSPRFMFEKSATYFDGEAVPKRSHALLPHAKIVTILISPAKRAYSWYQHQRSHGDV 888
                        ..:.||:..||..|.||||.:.:.|..|::.|:..|..|..|.:         
 Worm   109 ------------EIVIEKTPAYFTNEHVPKRVYEMNPDMKLILIVRHPVYRTVSDF--------- 152

  Fly   889 IANNYSFYQVITASDSAP----RALK---------DLRNRCLNPGKYAQHLEHWLAYYPAQQLHI 940
               ...:|..:..:.:.|    .|.|         ::..:.:....|..|:..||.|:..:....
 Worm   153 ---TQVYYNKLEQNKTLPVLSVEAFKTNEAGIEKINMEYKPMTNSLYDVHISKWLKYFDLKNFLF 214

  Fly   941 IDGEQLRLNPIDVMNELQRFLKIQPLLDYSNHLRYDVKKGFYCQAVSEKRNKCLGKSKGRQYPAM 1005
            ::|:..|.||:..:.:::.||.::..:..| .|.:|..|||:|...:.| .:|||.||||::.::
 Worm   215 VNGDVFRANPLRELRKVEEFLGLERSITPS-QLVFDYNKGFFCFRKTTK-VRCLGLSKGRKHRSV 277

  Fly  1006 DERSAKLLQRYYLNHNTALVKLLKK 1030
            .|.....|...:..||....:|:.:
 Worm   278 SEDVVAKLSNMFEEHNQNFFRLINR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sflNP_001163354.1 HSNSD 179..669 CDD:288882
Sulfotransfer_1 758..1017 CDD:279075 70/270 (26%)
hst-3.1NP_495230.2 Sulfotransfer_3 54..261 CDD:389806 59/238 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.