DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10147 and AZF1

DIOPT Version :9

Sequence 1:	NP_001261477.1	Gene:	CG10147 / 38733	FlyBaseID:	FBgn0035702	Length:	448	Species:	Drosophila melanogaster
Sequence 2:	NP_014756.3	Gene:	AZF1 / 854280	SGDID:	S000005639	Length:	914	Species:	Saccharomyces cerevisiae

Alignment Length:	185	Identity:	46/185 - (24%)
Similarity:	66/185 - (35%)	Gaps:	64/185 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly   257 KPLKTHMCEFCGRVFKTGSALSQHRFTHGDQLVLPYACELPECSMRFYSTEKLKIHMMRHQGIKN 321
            :.:|.|.|.:|.|:|.        :.||                        |::|:..|.|.|.
Yeast   588 RAVKKHECPYCHRLFS--------QATH------------------------LEVHVRSHIGYKP 620

  Fly   322 FSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYCEK 386
            |.|.|||.:.|....||.|...||.|                             :.|:|..|:|
Yeast   621 FVCDYCGKRFTQGGNLRTHERLHTGE-----------------------------KPYSCDICDK 656

  Fly   387 KFATTDTRKYHEMTHTGEKNFECHV--CGKKFIQPSALRTHR-KVHESGDNQQTA 438
            ||:.......|.:||...|.|.|.:  |.|.|.|...::.|: :.|:...|..||
Yeast   657 KFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETLNALTA 711

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10147	NP_001261477.1	zf-AD	7..80	CDD:214871
		C2H2 Zn finger	171..191	CDD:275368
		zf-C2H2_8	199..287	CDD:292531	8/29 (28%)
		C2H2 Zn finger	199..221	CDD:275368
		C2H2 Zn finger	230..253	CDD:275368
		C2H2 Zn finger	264..284	CDD:275368	4/19 (21%)
		C2H2 Zn finger	294..316	CDD:275368	2/21 (10%)
		C2H2 Zn finger	324..344	CDD:275368	8/19 (42%)
		C2H2 Zn finger	352..373	CDD:275368	0/20 (0%)
		C2H2 Zn finger	381..401	CDD:275368	6/19 (32%)
		C2H2 Zn finger	409..429	CDD:275368	6/22 (27%)
AZF1	NP_014756.3	COG5048	342..768	CDD:227381	46/185 (25%)
		C2H2 Zn finger	595..615	CDD:275368	8/51 (16%)
		C2H2 Zn finger	623..643	CDD:275368	8/19 (42%)
		C2H2 Zn finger	651..671	CDD:275368	6/19 (32%)
		C2H2 Zn finger	679..702	CDD:275368	6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100