DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and ZNF212

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_036388.2 Gene:ZNF212 / 7988 HGNCID:13004 Length:495 Species:Homo sapiens


Alignment Length:344 Identity:79/344 - (22%)
Similarity:111/344 - (32%) Gaps:127/344 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EELLLEPPEMIICDTNL-SAQNTPIVAEQAPPTLVFHTFTENVQQPPETEKKALEEP-----PLT 167
            |:..|.|.:     |.| ..|.:.::.|..|                  ....||||     |.:
Human   240 EQAFLSPEQ-----TELWGGQGSSVLLETGP------------------GDSTLEEPVGSRVPSS 281

  Fly   168 --TYKCDLCADEFREEKRLILHKKEHQGHML-------YHCTEPGCEEAFNRFENLRQHELEHSE 223
              |..|    .:.:..:::.|.::..||..|       |.|:|  ||..|...:.|..|...||.
Human   282 SRTVGC----PKQKSHRQVQLDQECGQGLKLKKDTSRPYECSE--CEITFRYKQQLATHLRSHSG 340

  Fly   224 VGMRFVCEEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEFCGRVFKTGSALSQHRFTHGDQL 288
            .|.   |..|......|.:..||....||       |.|.|:.|.|.|                 
Human   341 WGS---CTPEEPEESLRPRPRLKPQTKKA-------KLHQCDVCLRSF----------------- 378

  Fly   289 VLPYACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHI------NYHTLE 347
                :|               |:.::.||                    |.|:      ..|..|
Human   379 ----SC---------------KVSLVTHQ--------------------RCHLQEGPSAGQHVQE 404

  Fly   348 RTWSCKDCPKVCNSSTSLKKHIRAIHEKAR-DYACSYCEKKFATTDTRKYHEMTHTGEKNFECHV 411
            |.     .|   ||..:|..||.  ..|:| ...|.||.|.|:.......|:..||||:.:.|..
Human   405 RF-----SP---NSLVALPGHIP--WRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTE 459

  Fly   412 CGKKFIQPSALRTHRKVHE 430
            |.|.|:|...|..|:|:|:
Human   460 CEKSFVQKQHLLQHQKIHQ 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368 2/19 (11%)
zf-C2H2_8 199..287 CDD:292531 23/87 (26%)
C2H2 Zn finger 199..221 CDD:275368 7/21 (33%)
C2H2 Zn finger 230..253 CDD:275368 6/22 (27%)
C2H2 Zn finger 264..284 CDD:275368 4/19 (21%)
C2H2 Zn finger 294..316 CDD:275368 2/21 (10%)
C2H2 Zn finger 324..344 CDD:275368 2/25 (8%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
ZNF212NP_036388.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
KRAB_A-box 142..180 CDD:143639
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..290 8/47 (17%)
C2H2 Zn finger 318..338 CDD:275370 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 337..361 7/26 (27%)
COG5048 <367..479 CDD:227381 42/178 (24%)
C2H2 Zn finger 371..391 CDD:275368 9/75 (12%)
C2H2 Zn finger 429..449 CDD:275368 6/19 (32%)
zf-C2H2 429..449 CDD:306579 6/19 (32%)
zf-H2C2_2 441..466 CDD:316026 9/24 (38%)
C2H2 Zn finger 457..477 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..495 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.