DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and znf438

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001070629.1 Gene:znf438 / 798757 ZFINID:ZDB-GENE-060929-868 Length:746 Species:Danio rerio


Alignment Length:528 Identity:102/528 - (19%)
Similarity:165/528 - (31%) Gaps:163/528 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FSECTNLVVDP--DDQDILPSEICSECYELLEKFHSFRALCIIADNKWRSKSLVTWKKIDRRKPV 95
            ||:...::..|  ....|||       |..::  :|..|...:|...:..|..|:|.|...:.|.
Zfish   235 FSKAVQIIPSPPKGKLPILP-------YAKVK--NSLLAPTSLASTPFSDKQTVSWAKSSPKNPT 290

  Fly    96 YEVDEDEEEELELEELLLEPPEMIICDTNLSAQNTP--------------IVAEQAPPTLVFHTF 146
            ....:....:::.|.|..        |.|.:....|              |:|.:|........|
Zfish   291 ENKVKFINNKVKTESLSQ--------DLNNTQFKKPSGKKPGRKRKTMGDILAFEARKKRSLSFF 347

  Fly   147 TENVQQ--PPETEKKALEEP---------------------------PLTTYKC------DLCAD 176
            ...|.:  ||..:..|.::.                           ||.:...      ||.|.
Zfish   348 RRRVPEKPPPGVQNSASQQKFLDISKKYRSIRPKPVLVMEATIPQLVPLPSMSASDNPDQDLLAG 412

  Fly   177 EFREEKRL-------------ILHKKEHQG------HMLYHCTEPGCEEAFNRFENLRQHELEHS 222
            :....|.|             :|:.|.:.|      .:|:.|  |.|...|....:|:.|...||
Zfish   413 QQISGKTLSAPQSSQATDRQPVLNCKVNSGVIYTSSRLLHRC--PTCNRCFQFKHHLQSHMNSHS 475

  Fly   223 EVGMRFVCEEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEFCGRVF---------------- 271
            .: ..:||..  |.:.|.|..||..|....|...||.|:..||||.:.|                
Zfish   476 NL-RPYVCPV--CRKAYAHSGSLSTHMKLHHAESKPRKSLCCEFCEKSFGYVGVYFSHLREVHRV 537

  Fly   272 --KTGSALSQHRFTHGDQLVLPYACELPE-CSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTT 333
              ....::|||.    :.:.:..:.|:.| .|.:.....:|:|           .|..|.....|
Zfish   538 ILTVEPSISQHE----ESISVEESSEIDEQASEQRVDPVELQI-----------KCGRCQAITPT 587

  Fly   334 KNELRLHINY-HTLERTWSCKD--CPKVCNSSTSLKKHI----RAIHEKARDYACSYCEKKFATT 391
            ..:::||:.| |..|.....:|  ......:...|.||.    |.::||.....|..|.::|.:.
Zfish   588 FADMKLHLLYVHGEEVQVRLRDGAMHGGREAEDELVKHAAHYWRQLNEKRNLVHCGTCNEEFFSF 652

  Fly   392 DTRKYH-------------EMTHTGEK-----------------NFECHVCGKKFIQPSALRTHR 426
            ...|:|             |.....||                 :|.|.:|.|.|.:...:..|.
Zfish   653 SKFKHHLHSNHQESPEEEEEEEEKEEKMVIGKGLSKDISLRVGSHFNCILCSKVFNKKQEVIEHW 717

  Fly   427 KVHESGDN 434
            ....:.:|
Zfish   718 SAQHNCEN 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 10/48 (21%)
C2H2 Zn finger 171..191 CDD:275368 7/38 (18%)
zf-C2H2_8 199..287 CDD:292531 28/105 (27%)
C2H2 Zn finger 199..221 CDD:275368 6/21 (29%)
C2H2 Zn finger 230..253 CDD:275368 7/22 (32%)
C2H2 Zn finger 264..284 CDD:275368 8/37 (22%)
C2H2 Zn finger 294..316 CDD:275368 5/22 (23%)
C2H2 Zn finger 324..344 CDD:275368 6/20 (30%)
C2H2 Zn finger 352..373 CDD:275368 5/26 (19%)
C2H2 Zn finger 381..401 CDD:275368 6/32 (19%)
C2H2 Zn finger 409..429 CDD:275368 5/19 (26%)
znf438NP_001070629.1 zf-C2H2 452..474 CDD:278523 6/23 (26%)
C2H2 Zn finger 454..474 CDD:275368 6/21 (29%)
zf-H2C2_2 466..491 CDD:290200 8/27 (30%)
C2H2 Zn finger 482..502 CDD:275368 7/21 (33%)
C2H2 Zn finger 514..532 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.