DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and ZNF408

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_079017.1 Gene:ZNF408 / 79797 HGNCID:20041 Length:720 Species:Homo sapiens


Alignment Length:368 Identity:101/368 - (27%)
Similarity:147/368 - (39%) Gaps:61/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DEDEEEELELEELLLEPPEMIICDTNLSAQNTP-------------------------IVAEQAP 138
            |.|.:||...:..:  |||:   .:|.:.|..|                         ..::|.|
Human   258 DGDVDEECPAQAQM--PPEL---QSNSATQQDPDGSGASFSSSARGTQPHGYLAKKLHSPSDQCP 317

  Fly   139 PTLV----------FHTFTENVQQPPETEKKALEEPPLTTYKCDLCADEFREEKRLILHKKEHQG 193
            |...          |.|.:.:...|..:..|....     |:|..|...|.:...|..|...|.|
Human   318 PRAKTPEPGAQQSGFPTLSRSPPGPAGSSPKQGRR-----YRCGECGKAFLQLCHLKKHAFVHTG 377

  Fly   194 HMLYHCTEPGCEEAFNRFENLRQHELEHSEVGMR-FVCEEEGCNRMYRHKASLKYHQSKAHDIGK 257
            |..:.|||  |.::::..|:.:.|.|.|.  |:| |.|.:  |::.|..:..||.|| ..|...:
Human   378 HKPFLCTE--CGKSYSSEESFKAHMLGHR--GVRPFPCPQ--CDKAYGTQRDLKEHQ-VVHSGAR 435

  Fly   258 PLKTHMCEFCGRVFKTGSALSQHRFTHGDQL-VLPYACELPECSMRFYSTEKLKIHMMRHQGIKN 321
            |.   .|:.||:.|....:|..||.||  |: ..|..|..|.|.....:...|:.||..|.|.|.
Human   436 PF---ACDQCGKAFARRPSLRLHRKTH--QVPAAPAPCPCPVCGRPLANQGSLRNHMRLHTGEKP 495

  Fly   322 FSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYCEK 386
            |.||:||.....:..||.|:..||.||.:.|..|.........|::|:  |......:.|..|.|
Human   496 FLCPHCGRAFRQRGNLRGHLRLHTGERPYRCPHCADAFPQLPELRRHL--ISHTGEAHLCPVCGK 558

  Fly   387 KFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHRKVH 429
            ......|.:.||..|:||:.|.|..||:.:...:.||.|.|.|
Human   559 ALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLRRHLKSH 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)
zf-C2H2_8 199..287 CDD:292531 29/88 (33%)
C2H2 Zn finger 199..221 CDD:275368 7/21 (33%)
C2H2 Zn finger 230..253 CDD:275368 7/22 (32%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..373 CDD:275368 4/20 (20%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
ZNF408NP_079017.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..350 17/96 (18%)
COG5048 <308..516 CDD:227381 64/224 (29%)
C2H2 Zn finger 355..375 CDD:275368 5/19 (26%)
zf-H2C2_2 367..392 CDD:290200 9/26 (35%)
C2H2 Zn finger 383..403 CDD:275368 7/21 (33%)
C2H2 Zn finger 411..431 CDD:275368 7/22 (32%)
zf-H2C2_2 423..448 CDD:290200 10/28 (36%)
C2H2 Zn finger 439..490 CDD:275368 17/52 (33%)
COG5048 <475..642 CDD:227381 41/129 (32%)
zf-H2C2_2 482..507 CDD:290200 11/24 (46%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..533 CDD:290200 9/22 (41%)
C2H2 Zn finger 526..546 CDD:275368 5/21 (24%)
C2H2 Zn finger 553..573 CDD:275368 6/19 (32%)
zf-H2C2_2 566..589 CDD:290200 9/22 (41%)
C2H2 Zn finger 581..601 CDD:275368 7/19 (37%)
zf-H2C2_2 594..617 CDD:290200 5/8 (63%)
C2H2 Zn finger 609..629 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.