DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and Zfp935

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_849206.2 Gene:Zfp935 / 71508 MGIID:1918758 Length:353 Species:Mus musculus


Alignment Length:410 Identity:105/410 - (25%)
Similarity:167/410 - (40%) Gaps:62/410 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NLLHHPYLAVKFSECTNLVVDPDDQDILPSEICSECYELLEKFHSFRALCIIADNKWRSKSLVTW 86
            |.:.:..:.|.|::....::|| .|..|..::..|.|         |.|..|..| |.:.::..:
Mouse     2 NAVTYEDVHVNFTQEEWALLDP-SQKKLYKDVMVETY---------RNLNAIGFN-WEAHNIEEY 55

  Fly    87 KKIDRRKPVYEVDEDEEEELELEELLLEPPEMIICDTNLSAQNTPIVAEQAPPTLVFHTFTENVQ 151
            .:..||....|..:..|          :|.|...|....:              |..|:..:. .
Mouse    56 CQSSRRHRRCERSQSAE----------KPSEYTQCGKAFA--------------LHAHSHAQR-H 95

  Fly   152 QPPETEKKALEEPPLTTYKCDLCADEFREEKRLILHKKEHQGHMLYHCTEPGCEEAFNRFENLRQ 216
            :...|||        .|.:...|.::|.....|.:||:...|...|.|.:  |.:.|.....|::
Mouse    96 ERIHTEK--------ITSEVIHCVEDFLPYTSLQVHKRTQTGQKPYECNQ--CGKGFRMPSCLKR 150

  Fly   217 HELEHSEVGMR-FVCEEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEFCGRVFKTGSALSQH 280
            ||..|:  |.: :.|.:  |.:.:...:.||.|: :.|...||.|   |..|.:.|.....|..|
Mouse   151 HERIHT--GEKPYECNQ--CGKGFITPSHLKRHE-RIHTGEKPYK---CNQCDKAFSQYVHLQIH 207

  Fly   281 RFTH-GDQLVLPYACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYH 344
            |.|| |::   |:.|:  ||...|.....|:.|...|.|.|.:.|..|....:....|.:|...|
Mouse   208 RSTHTGEK---PFKCD--ECDKAFSKHFHLQNHKRTHTGEKPYKCNQCNKAFSQHTNLHIHRRTH 267

  Fly   345 TLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFEC 409
            |.|:.:.|.:|.||.:....|:.||:. |...:.|.|:.|.|.|....:.:.|...|||||.::|
Mouse   268 TGEKPFKCNECDKVFSQFGHLQIHIKT-HTGDKPYKCNQCNKAFYQKRSLQTHIRIHTGEKPYKC 331

  Fly   410 HVCGKKFIQPSALRTHRKVH 429
            :.|.|.|.|...|..||::|
Mouse   332 NQCDKAFSQYGHLYIHRRIH 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 14/57 (25%)
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)
zf-C2H2_8 199..287 CDD:292531 26/89 (29%)
C2H2 Zn finger 199..221 CDD:275368 6/21 (29%)
C2H2 Zn finger 230..253 CDD:275368 5/22 (23%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 4/19 (21%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
Zfp935NP_849206.2 KRAB 4..>45 CDD:214630 11/50 (22%)
KRAB 4..40 CDD:279668 9/45 (20%)
C2H2 Zn finger 78..99 CDD:275368 3/35 (9%)
COG5048 <130..293 CDD:227381 50/177 (28%)
C2H2 Zn finger 135..155 CDD:275368 6/21 (29%)
zf-H2C2_2 148..172 CDD:290200 7/27 (26%)
C2H2 Zn finger 163..183 CDD:275368 5/22 (23%)
zf-H2C2_2 175..200 CDD:290200 10/28 (36%)
C2H2 Zn finger 191..211 CDD:275368 6/19 (32%)
zf-H2C2_2 203..227 CDD:290200 10/28 (36%)
C2H2 Zn finger 219..239 CDD:275368 6/21 (29%)
zf-H2C2_2 231..256 CDD:290200 7/24 (29%)
C2H2 Zn finger 247..267 CDD:275368 4/19 (21%)
zf-H2C2_2 263..284 CDD:290200 8/20 (40%)
C2H2 Zn finger 275..295 CDD:275368 7/20 (35%)
zf-H2C2_2 287..310 CDD:290200 8/23 (35%)
COG5048 298..>352 CDD:227381 20/54 (37%)
C2H2 Zn finger 303..323 CDD:275368 5/19 (26%)
zf-H2C2_2 315..340 CDD:290200 10/24 (42%)
C2H2 Zn finger 331..351 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.