DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and ZNF692

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_011542525.1 Gene:ZNF692 / 55657 HGNCID:26049 Length:625 Species:Homo sapiens


Alignment Length:181 Identity:50/181 - (27%)
Similarity:73/181 - (40%) Gaps:34/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 IGKPLKTHM--CEF--CGRVFKTGSALSQH-RFTHGDQLVLPYACELPECSMRFYSTEKLKIHMM 314
            |.|..|..:  |:|  |||:|.....|:.| ::.|..|  ..::|..|.|...|...:.||.||.
Human   425 IRKAAKRELMPCDFPGCGRIFSNRQYLNHHKKYQHIHQ--KSFSCPEPACGKSFNFKKHLKEHMK 487

  Fly   315 RHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDY 379
            .|...:::.|.:|.....|.:.|.:|...||.|:...|:.|...|....||..|           
Human   488 LHSDTRDYICEFCARSFRTSSNLVIHRRIHTGEKPLQCEICGFTCRQKASLNWH----------- 541

  Fly   380 ACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHR-KVH 429
                 ::|.|.|          .....|.|..|||:|.:|.::..|| |.|
Human   542 -----QRKHAET----------VAALRFPCEFCGKRFEKPDSVAAHRSKSH 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368
zf-C2H2_8 199..287 CDD:292531 12/36 (33%)
C2H2 Zn finger 199..221 CDD:275368
C2H2 Zn finger 230..253 CDD:275368
C2H2 Zn finger 264..284 CDD:275368 8/22 (36%)
C2H2 Zn finger 294..316 CDD:275368 8/21 (38%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 3/19 (16%)
C2H2 Zn finger 409..429 CDD:275368 9/20 (45%)
ZNF692XP_011542525.1 zf-C2H2 465..489 CDD:278523 8/23 (35%)
C2H2 Zn finger 467..489 CDD:275368 8/21 (38%)
COG5048 490..>591 CDD:227381 28/114 (25%)
zf-C2H2 495..517 CDD:278523 5/21 (24%)
C2H2 Zn finger 497..517 CDD:275368 5/19 (26%)
zf-H2C2_2 509..534 CDD:290200 8/24 (33%)
C2H2 Zn finger 525..545 CDD:275368 6/35 (17%)
C2H2 Zn finger 556..577 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.