DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and topi

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster


Alignment Length:452 Identity:104/452 - (23%)
Similarity:171/452 - (37%) Gaps:121/452 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KFSECTNLV--VDPDDQDILPSEI-----------------CSECYELLEKFH----SFRALCII 73
            ||...:.||  ::....|::||:.                 |:.|..:   |:    :||. .:|
  Fly   236 KFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAAGLHVVVKCNSCGRI---FYDPQVAFRH-GLI 296

  Fly    74 ADNKWRSKSLVTWKKIDRRKPVYEVDEDEEEELELEELLLEPPEMIICDTNLSAQNTPIVAEQAP 138
            .|::..:.         |:.|:.:|..:   ..:..||||: .||:|       .|.|       
  Fly   297 HDSEHSTM---------RQSPMTQVPSN---RADFNELLLD-GEMLI-------DNDP------- 334

  Fly   139 PTLVFHTFTENVQQPPETEKKALEEPPL--TTYKCDLCADEFREEKRLILHKKEHQGHMLYHCTE 201
               .|.|..:|...|    ||.:....:  :..:|:.|...|.:...|::|...|.....:.|| 
  Fly   335 ---AFATSNQNTNPP----KKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERRFECT- 391

  Fly   202 PGCEEAFNRFENLRQHELEHSEVGMRFVCEEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEF 266
             .|:...|..:          |..:.|   :..|..|.....||....|         :..:|..
  Fly   392 -ACDIQMNTAK----------EASIHF---QTDCIFMREAIRSLNVTLS---------RYFVCNV 433

  Fly   267 CGRVFKTGSALSQHRFT----------HGDQLVLPYACELPECSMRF------YSTEKLKIHM-- 313
            |...|.....|.:||.|          :|.:|:||  |:..:.:..|      :|.||   |:  
  Fly   434 CELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLP--CDFCDVNFEFAHDFLAHSEEK---HLNK 493

  Fly   314 ------MRHQG---IKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKD--CPKVCNSSTSLKK 367
                  .|:.|   |:.:.|..||...|..:.|..|:.:|...:.:.|::  |.:.......|..
  Fly   494 KKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLND 558

  Fly   368 HIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHRKVH 429
            |||..|...|.|.|..|.|:|.|......|.:.|.||:.:||..|||:|.:..||:.|:::|
  Fly   559 HIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIH 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 14/70 (20%)
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)
zf-C2H2_8 199..287 CDD:292531 19/97 (20%)
C2H2 Zn finger 199..221 CDD:275368 4/21 (19%)
C2H2 Zn finger 230..253 CDD:275368 5/22 (23%)
C2H2 Zn finger 264..284 CDD:275368 7/29 (24%)
C2H2 Zn finger 294..316 CDD:275368 6/35 (17%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 6/22 (27%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 4/13 (31%)
C2H2 Zn finger 277..297 CDD:275368 5/23 (22%)
C2H2 Zn finger 431..453 CDD:275368 7/21 (33%)
COG5048 <450..647 CDD:227381 49/176 (28%)
C2H2 Zn finger 469..490 CDD:275368 5/23 (22%)
zf-C2H2 511..533 CDD:278523 6/21 (29%)
C2H2 Zn finger 513..564 CDD:275368 13/50 (26%)
C2H2 Zn finger 541..561 CDD:275368 4/19 (21%)
zf-H2C2_2 555..581 CDD:290200 11/25 (44%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 10/23 (43%)
zf-C2H2 598..620 CDD:278523 9/21 (43%)
C2H2 Zn finger 600..620 CDD:275368 8/19 (42%)
zf-H2C2_2 612..637 CDD:290200 4/9 (44%)
C2H2 Zn finger 628..646 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.