DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and CG14655

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:336 Identity:81/336 - (24%)
Similarity:117/336 - (34%) Gaps:78/336 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PPETEKKALEE-------PPLTT---YKCDLCADEFREEKRLILHKKEHQGHMLYHCTEPGCEEA 207
            ||:...|....       ||:.|   ..||:|...||..:...:|.:      |.|....|    
  Fly    86 PPKRRAKRTRSKPVVPTPPPVRTTPPAHCDICEFSFRNTELRDMHVR------LVHENAEG---- 140

  Fly   208 FNRFENLRQHELEHSEVGMR-FVCEEEGCNRMYRHKASLKYHQSKAHDIGKPLK----------- 260
                 ..:|.|.:..|.... :.|..  |::.:|.|.||:.|....|.:|.|..           
  Fly   141 -----EPKQKEPQQKEPDQEPYKCHL--CSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPT 198

  Fly   261 ----------THMCEFCGRVFKT-------GS----ALSQHRFTHGDQLVLPYACELPECSMRFY 304
                      |.....|.|:..|       |:    ..||.....|...:|..:...||...   
  Fly   199 PASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGT--- 260

  Fly   305 STEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHI 369
            :|.||            :.|..|....|||..|:.|...||.|..::|:.|.:......|..||:
  Fly   261 ATPKL------------WECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHL 313

  Fly   370 RAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHRKVHESGDN 434
             ..|.:.:.:.|..|.:.|....|...|:..|:|||.|:|.||||.|.|..:...|.::|..  .
  Fly   314 -LYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTG--V 375

  Fly   435 QQTACALLQLT 445
            ....|.|.|.|
  Fly   376 MPYKCELCQKT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368 6/19 (32%)
zf-C2H2_8 199..287 CDD:292531 22/120 (18%)
C2H2 Zn finger 199..221 CDD:275368 3/21 (14%)
C2H2 Zn finger 230..253 CDD:275368 7/22 (32%)
C2H2 Zn finger 264..284 CDD:275368 6/30 (20%)
C2H2 Zn finger 294..316 CDD:275368 5/21 (24%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 7/22 (32%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
zf-H2C2_2 339..361 CDD:290200 12/21 (57%)
C2H2 Zn finger 352..372 CDD:275368 8/19 (42%)
zf-H2C2_2 364..389 CDD:290200 6/25 (24%)
C2H2 Zn finger 380..396 CDD:275368 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.