DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and ZNF772

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001019767.1 Gene:ZNF772 / 400720 HGNCID:33106 Length:489 Species:Homo sapiens


Alignment Length:301 Identity:85/301 - (28%)
Similarity:124/301 - (41%) Gaps:46/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 PPLTTYKCDLCADEFREEKRLILHKKEHQGH-----------MLYHCTEPGCEEAFNRFE----- 212
            |....|.|.||..:|.....|..|:|:|.|.           :|.:|.....|.:|...|     
Human   167 PGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPFLLNNCAVQSMEMSFVTGEACKDF 231

  Fly   213 ----NLRQHELEHSE--------------VGMR-FVCEEEGCNRMYRHKASLKYHQSKAHDIGKP 258
                ::.:|...|:|              .|.| :.|.|  |.:.:..|.||..|| :.|...:|
Human   232 LASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSE--CGKTFSRKDSLVQHQ-RVHTGERP 293

  Fly   259 LKTHMCEFCGRVFKTGSALSQHRFTHGDQLVLPYACELPECSMRFYSTEKLKIHMMRHQGIKNFS 323
               :.|..||:.|.....|:||:..|..:  :||.|.:  |...|..:..|.:|...|.|.:.:.
Human   294 ---YECGECGKTFSRKPILAQHQRIHTGE--MPYECGI--CGKVFNHSSNLIVHQRVHTGARPYK 351

  Fly   324 CPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYCEKKF 388
            |..||...:.|:.|..|.:.||.||.:.|.:|.|.......|.|| .::|..||.|.|..|.|.|
Human   352 CSECGKAYSHKSTLVQHESIHTGERPYECSECGKYFGHKYRLIKH-WSVHTGARPYECIACGKFF 415

  Fly   389 ATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHRKVH 429
            :.:.....|:..|.|||.:.|..|||.|.....|..|.::|
Human   416 SQSSDLIAHQRVHNGEKPYVCSECGKAFSHKHVLVQHHRIH 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368 7/19 (37%)
zf-C2H2_8 199..287 CDD:292531 27/111 (24%)
C2H2 Zn finger 199..221 CDD:275368 5/30 (17%)
C2H2 Zn finger 230..253 CDD:275368 8/22 (36%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
C2H2 Zn finger 294..316 CDD:275368 5/21 (24%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
ZNF772NP_001019767.1 KRAB 27..87 CDD:214630
KRAB 27..66 CDD:279668
C2H2 Zn finger 146..166 CDD:275368
COG5048 158..>464 CDD:227381 85/301 (28%)
C2H2 Zn finger 174..194 CDD:275368 7/19 (37%)
zf-C2H2 266..288 CDD:278523 8/24 (33%)
C2H2 Zn finger 268..288 CDD:275368 8/22 (36%)
zf-H2C2_2 280..305 CDD:290200 10/28 (36%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 309..333 CDD:290200 9/27 (33%)
C2H2 Zn finger 324..344 CDD:275368 5/21 (24%)
zf-H2C2_2 336..361 CDD:290200 7/24 (29%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
zf-H2C2_2 365..387 CDD:290200 9/21 (43%)
C2H2 Zn finger 380..400 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..428 CDD:275368 5/19 (26%)
zf-H2C2_2 420..445 CDD:290200 10/24 (42%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
zf-H2C2_2 449..473 CDD:290200 3/8 (38%)
C2H2 Zn finger 464..484 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.