DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and CG7386

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster


Alignment Length:464 Identity:141/464 - (30%)
Similarity:208/464 - (44%) Gaps:57/464 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRVCSSDVARDDEAYNLLHHPYLAVKFSECTNLVVDPDDQDILPSEICSECYELLEKFHSFRALC 71
            |..|...: :....::|...|.|..|...||:.  |.|..|..|..:|::|:..|...|.||.||
  Fly    11 CLTCLVHL-KHGAGHDLFVVPDLFQKLRACTSF--DADQNDGFPRNLCTQCFTKLNDLHDFRELC 72

  Fly    72 IIADNKWRSKSLVTWKKIDRRKP--VYE--VDEDE-----EEELELEELLLEPPEMIICDTNLSA 127
              |::..|.|.::|   ..|..|  |:|  .|:.|     ||....:.||....|||..:.::..
  Fly    73 --AESIKRLKEMMT---SQRNMPMGVFESIADDSEAPERPEEPASFDPLLNNKLEMIDNEEDVFK 132

  Fly   128 QNTPIVAEQAPPTLVFHTFTENVQQPPETEKKALEEPP--------------------------L 166
                 :.|:....|..|:..::.:.....|...|||..                          .
  Fly   133 -----LLEKVDKELEEHSRDQSEEHFSSAEHNGLEEEKKESEGFNSDDEQAMGQRRIANDKRKLF 192

  Fly   167 TTYKCDLCADEFREEKRLILHKKEHQGHMLYHCTEPGCEEAFNRFENLRQH-ELEHSEVGMRFVC 230
            ....|.:|..:|:::.:...|.|.|...:.:.|.|..|.:.|.....||.| :..||:......|
  Fly   193 RLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLHVDYAHSKKEDTVPC 257

  Fly   231 EEEGCNRMYRHKASLKYHQSKAHDIGK---PLKTHMCEFCGRVFKTGSALSQHRFTH-GDQLVLP 291
            ..|||..::.....|..|..|.|:..:   |.....|:.||.||:...|:.:|.:|| |::  ||
  Fly   258 TVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAMKKHMYTHTGEE--LP 320

  Fly   292 YACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCP 356
            |.|.:  |...||....||.|::||.||||:.|.|||::|||:.|...||..||....:.|:.|.
  Fly   321 YPCTI--CGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIHTQRNQFKCRICD 383

  Fly   357 KVCNSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSA 421
            ...::...|:.|::.:|||.|::||.||.|.|......|.|||.|||||..||.||.|||:...:
  Fly   384 YATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCECKVCDKKFLHSES 448

  Fly   422 LRTHRKVHE 430
            |..|.|:||
  Fly   449 LNNHLKIHE 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 21/72 (29%)
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)
zf-C2H2_8 199..287 CDD:292531 28/92 (30%)
C2H2 Zn finger 199..221 CDD:275368 7/22 (32%)
C2H2 Zn finger 230..253 CDD:275368 7/22 (32%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
C2H2 Zn finger 294..316 CDD:275368 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 10/19 (53%)
C2H2 Zn finger 352..373 CDD:275368 4/20 (20%)
C2H2 Zn finger 381..401 CDD:275368 9/19 (47%)
C2H2 Zn finger 409..429 CDD:275368 9/19 (47%)
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 22/74 (30%)
C2H2 Zn finger 197..217 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..314 CDD:275368 7/19 (37%)
C2H2 Zn finger 323..343 CDD:275368 7/21 (33%)
C2H2 Zn finger 351..371 CDD:275368 10/19 (53%)
C2H2 Zn finger 379..400 CDD:275368 4/20 (20%)
C2H2 Zn finger 408..428 CDD:275368 9/19 (47%)
C2H2 Zn finger 436..456 CDD:275368 9/19 (47%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H77239
Inparanoid 1 1.050 123 1.000 Inparanoid score I3296
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010000
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.