DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and Zbtb48

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_038966377.1 Gene:Zbtb48 / 362668 RGDID:1311581 Length:739 Species:Rattus norvegicus


Alignment Length:474 Identity:103/474 - (21%)
Similarity:153/474 - (32%) Gaps:154/474 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NKWRSKSLVTWKKIDRRKPVYEVDEDEEEELELEELLLEPPEMIICDTNLSAQNTPIVAEQAPPT 140
            |:|              :.|.:|::|.:.:.:    ....||.::..........|..||   |.
  Rat   222 NEW--------------EVVVQVEDDRDGDGD----YASEPETVLTRRKSKVIRKPCAAE---PA 265

  Fly   141 LVFHTFTENVQQPPETEKKALEEPPLTTYKCDLCADEFREEKRLILHKKEHQGHMLYHCTEPGCE 205
            |...:.|   .:|.|..|.|     ....:|..|..:|..:..|.:|.::|.|...:.|  |.|.
  Rat   266 LGAGSLT---AEPTEGRKGA-----AVPVECPTCHKKFLSKYYLKVHNRKHTGEKPFEC--PKCG 320

  Fly   206 EAFNRFENLRQHE----LEHSEVGMRFVCEEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEF 266
            :.:.|.|||.:||    :..||  ..|.|..  |...:|.:..|:.|. .:|....|.|   |..
  Rat   321 KCYFRKENLLEHEARNCMNRSE--QVFTCSV--CQETFRRRMELRVHM-VSHTGEMPYK---CSS 377

  Fly   267 CGRVFKTGSALSQHRF-THG---------------------------DQLVLPY--ACELP---- 297
            |.:.|.....|..|.. .||                           |.|.||.  :|..|    
  Rat   378 CSQQFMQKKDLQSHMIKLHGAPKPHAVSAKQGWGSCGPWTAQPCPHLDSLPLPVSPSCSAPLVPS 442

  Fly   298 -ECSMRFYS-TEKLKIHMMRHQGIKNF-------------SCPYCGLK--------------KTT 333
             .|..|.|| |..|.|.......:||.             |.|..|:|              :.|
  Rat   443 ASCLGRSYSCTRLLSIVEKSSLCVKNVGTGPQAAMGCRCTSRPSTGMKGRMSVSSAAMHSPRRPT 507

  Fly   334 KN------------------------------------------------ELRLHINYHTLERTW 350
            ..                                                .|..|...||.||.:
  Rat   508 STCTCAHTQERSPSSATSVGRPSAPKVRQARPLLASGLRQVLSSTLSPTASLDKHNRTHTGERPF 572

  Fly   351 SCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKK 415
            ||:.|.:.......|.:|:.:.|::.|.:.|..|.|.|...:..:.|...|.|.:.|||..||.|
  Rat   573 SCEFCEQRFTEKGPLLRHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYK 637

  Fly   416 FIQPSALRTHRKVHESGDN 434
            |.:.:.||.|.::|:..:|
  Rat   638 FTRQAHLRRHMEIHDRVEN 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 2/3 (67%)
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)
zf-C2H2_8 199..287 CDD:292531 27/119 (23%)
C2H2 Zn finger 199..221 CDD:275368 9/25 (36%)
C2H2 Zn finger 230..253 CDD:275368 5/22 (23%)
C2H2 Zn finger 264..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 294..316 CDD:275368 9/27 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/81 (7%)
C2H2 Zn finger 352..373 CDD:275368 4/20 (20%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
Zbtb48XP_038966377.1 BTB_POZ_ZBTB48_TZAP_KR3 8..115 CDD:349541
C2H2 Zn finger 288..308 CDD:275368 5/19 (26%)
zf-H2C2_2 300..323 CDD:404364 7/24 (29%)
C2H2 Zn finger 316..367 CDD:275368 17/57 (30%)
zf-C2H2 345..367 CDD:395048 6/24 (25%)
zf-H2C2_2 359..382 CDD:404364 7/26 (27%)
C2H2 Zn finger 375..396 CDD:275368 5/20 (25%)
C2H2 Zn finger 574..595 CDD:275368 4/20 (20%)
C2H2 Zn finger 603..623 CDD:275368 5/19 (26%)
zf-H2C2_2 616..640 CDD:404364 10/23 (43%)
zf-C2H2 629..651 CDD:395048 10/21 (48%)
C2H2 Zn finger 631..651 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.