DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and CG8944

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster


Alignment Length:348 Identity:83/348 - (23%)
Similarity:120/348 - (34%) Gaps:125/348 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 EQAPPTLVFHTFTENVQQPPETEKKALEEPPLT--TYKCDLCADEFREEKRLILHKKEHQG---H 194
            :..||....|. .|.||...|.:...|...|..  .|.|::|:.:|...:....||:.|.|   .
  Fly   469 DDIPPFKCAHC-PEIVQTLRELDLHMLTHQPSLGGGYYCNICSIQFHNAQEFDNHKQLHLGGVTE 532

  Fly   195 MLYHCTEPGCEEAF----NRFENLRQHE---------LEHS---------EVGMRFVCEE---EG 234
            :.::|..  |..:|    |..|:||:|.         |.||         |:|:.  .||   .|
  Fly   533 IKFNCEL--CTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVE--GEESRGSG 593

  Fly   235 CNRMYRHKASLKYHQSKA-----------------------HDIGKPLKTHMCEFCGRVFKTGSA 276
            ..|..||.|       ||                       .||.||   :.|:.|.|.|.|...
  Fly   594 SRRKRRHAA-------KATDDMVDDDDRIGGGGGGGSGGGGTDIAKP---YGCDVCRRSFATPGH 648

  Fly   277 LSQHRFTHGDQLVLPYACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHI 341
            |:.||..|.|:....|.|:.|:|:..|.:...|..|:.:|...:.|.|..||  ||.|       
  Fly   649 LNAHRIVHQDERERCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFKCDICG--KTFK------- 704

  Fly   342 NYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKN 406
                               |:.:|:.| :.||:|.:.|.                          
  Fly   705 -------------------STKNLQNH-KQIHDKIKRYV-------------------------- 723

  Fly   407 FECHVCGKKFIQPSALRTHRKVH 429
              |.:||..|.|.:.|..|::.|
  Fly   724 --CQICGSAFAQAAGLYLHKRRH 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)
zf-C2H2_8 199..287 CDD:292531 35/135 (26%)
C2H2 Zn finger 199..221 CDD:275368 9/34 (26%)
C2H2 Zn finger 230..253 CDD:275368 9/48 (19%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 3/20 (15%)
C2H2 Zn finger 381..401 CDD:275368 0/19 (0%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738 0/2 (0%)
C2H2 Zn finger 476..496 CDD:275368 6/20 (30%)
C2H2 Zn finger 506..526 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 7/21 (33%)
C2H2 Zn finger 636..656 CDD:275368 8/19 (42%)
zf-C2H2_8 639..712 CDD:292531 26/100 (26%)
C2H2 Zn finger 666..688 CDD:275368 6/21 (29%)
zf-C2H2 694..716 CDD:278523 10/50 (20%)
C2H2 Zn finger 696..716 CDD:275368 9/48 (19%)
zf-H2C2_2 708..733 CDD:290200 10/53 (19%)
C2H2 Zn finger 724..744 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.