DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and CG11696

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:472 Identity:101/472 - (21%)
Similarity:171/472 - (36%) Gaps:125/472 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DPDDQDILP-------SEICSECYELLEKFHSFRALCIIADNKWRSKSLVT----------WKKI 89
            :|:...:.|       .....:.::::::.:..|        |.::|:.:|          .:::
  Fly   163 EPEPDPVKPRPRGRPRKTALQQTHQIIKRKYEKR--------KQQNKAKITELSLRESRARQREL 219

  Fly    90 DRRKPVYEVDEDEEEELELEELLLEPPEMIICDTNLSAQNTPIVAEQAPP----------TLVFH 144
            .|.....|.|:|.:|:.|.||             ::..:.||...||..|          .||..
  Fly   220 KRSSAGAEDDQDGDEDEEDEE-------------DVGGELTPDADEQPKPRGKRGRPKTKKLVTA 271

  Fly   145 TFTENVQQPPETEKKALEEPPLTTY-------KCDLCA---DEFREEKRLILHKKEHQGHM---- 195
            ...::..:.| .::.:::|  :..|       .|.:||   ::|.:.||....:.:..|::    
  Fly   272 DDNDDTSEVP-VKRSSIKE--MDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCN 333

  Fly   196 -------LY----HC-TEP---GCEEAFNRFEN--------LRQHELEHSEVGMRFVCEEEGCNR 237
                   ||    || .:|   .|:.....|.|        ||.|..:...|....:||..    
  Fly   334 NRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEAR---- 394

  Fly   238 MYRHKASLKYHQSKAHDIGKPLKTH-------MCEFCGRVFKTGSALSQH--RFTHGDQLVLPYA 293
             :..|..|..|          ||.|       :|:.|.:.|:|...||.|  |....|  ..|..
  Fly   395 -FAKKFLLTMH----------LKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAAD--FTPII 446

  Fly   294 CELPECSMRFYSTEKLKIH--MMRHQG-IKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDC 355
            |::  |...|.|.....||  .:...| :....|..||.....:..||.|:..|. :|....|..
  Fly   447 CDI--CGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHD-DRDGDTKYR 508

  Fly   356 PKVCN----SSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKF 416
            ..:||    |..:|..|:| .|..|:.:.||.|:|:|........|..||||...::|..|.:.|
  Fly   509 CLLCNAEKSSRAALSSHMR-YHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTF 572

  Fly   417 IQPSALRTHRKVHESGD 433
            ...:.:..|:|.....|
  Fly   573 KSHANMHNHKKKMHPND 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 4/44 (9%)
C2H2 Zn finger 171..191 CDD:275368 6/22 (27%)
zf-C2H2_8 199..287 CDD:292531 25/108 (23%)
C2H2 Zn finger 199..221 CDD:275368 8/33 (24%)
C2H2 Zn finger 230..253 CDD:275368 5/22 (23%)
C2H2 Zn finger 264..284 CDD:275368 8/21 (38%)
C2H2 Zn finger 294..316 CDD:275368 6/23 (26%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 7/24 (29%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 5/19 (26%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 3/16 (19%)
C2H2 Zn finger 357..378 CDD:275368 5/20 (25%)
C2H2 Zn finger 388..408 CDD:275368 7/34 (21%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 447..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..529 CDD:275368 6/20 (30%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.