DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and CG18262

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:465 Identity:106/465 - (22%)
Similarity:163/465 - (35%) Gaps:127/465 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRVCSSDVARD--DEAYNLLHHPYLAVKFSECTN-LVVDPDDQDILPSEICSECYELLEKFHSFR 68
            |.:|...:..|  .|.:.|.|  :.....|.|:| |..||..||::..:...|.:|.|.|     
  Fly    34 CLLCDQRLPLDGYPEHFRLKH--FTNSSSSLCSNELESDPIAQDVVEVQGNEELHEELAK----- 91

  Fly    69 ALCIIADNKWRSKSLVTWKKIDRRKPVYEVDEDEEEELELEELLLEPPEMIICDTNLSAQNTPIV 133
                                  ...|..|.:|:|:||....:.......|         :||.: 
  Fly    92 ----------------------EASPDLEEEEEEKEEGSKRQHYQRAAAM---------KNTLV- 124

  Fly   134 AEQAPPTLVFHTFTENVQQPPETEKKALEEPPLTTYKCDLCADEFREEKRLILHKKEHQGH---- 194
                                 ||.:..|:      .:.|....|..|      |.:.|:..    
  Fly   125 ---------------------ETREDLLD------IELDWTGGEQSE------HNETHEEEEGES 156

  Fly   195 -------------MLYHCTEPGCEEAFNRFENLRQH-ELEHSEVG-------------------- 225
                         ||:.|.:  |:.|:|...:|:.| .|:|||..                    
  Fly   157 DDDDTKDSNDTKDMLFQCDQ--CDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPP 219

  Fly   226 MRFVCEEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEFCGRVFKTGSALSQHRFTHGDQLVL 290
            ..:.|.||.||:.:|.:..|:.|:.|...|       .|:.||:.|.....:.:||..|..  :.
  Fly   220 KVYKCNEEACNQTFRTERDLRGHRWKHTGI-------FCDICGKPFTQSGNMMRHRQRHSG--IK 275

  Fly   291 PYACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDC 355
            |:.|  |||...||:.::|..|.:.|.|.....|..||.....:..|..|:..||.||...|:.|
  Fly   276 PHKC--PECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVC 338

  Fly   356 PKVCNSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPS 420
            .|...|...|..| ...|...|.:.|..|...|......:.|::.|:.::.:.|.:|||.|.|..
  Fly   339 GKAFYSFHDLNVH-AVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSG 402

  Fly   421 ALRTHRKVHE 430
            .|..|.:.|:
  Fly   403 GLNAHMRSHD 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 18/75 (24%)
C2H2 Zn finger 171..191 CDD:275368 4/19 (21%)
zf-C2H2_8 199..287 CDD:292531 27/108 (25%)
C2H2 Zn finger 199..221 CDD:275368 7/22 (32%)
C2H2 Zn finger 230..253 CDD:275368 9/22 (41%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
C2H2 Zn finger 294..316 CDD:275368 8/21 (38%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 4/19 (21%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 8/21 (38%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
COG5048 <256..415 CDD:227381 46/162 (28%)
zf-H2C2_2 263..288 CDD:290200 9/28 (32%)
C2H2 Zn finger 279..327 CDD:275368 15/49 (31%)
zf-H2C2_2 320..342 CDD:290200 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 6/20 (30%)
C2H2 Zn finger 363..383 CDD:275368 4/19 (21%)
zf-C2H2 389..411 CDD:278523 8/21 (38%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.