DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and CG2129

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:485 Identity:114/485 - (23%)
Similarity:184/485 - (37%) Gaps:123/485 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PDDQDILPSEICSECYELLEKFHSFRALCIIADNK---------------WRSKSLVT------- 85
            ||....:.:..|.|.|  .:..||||..|...:.|               :.:..|.|       
  Fly     7 PDTYAGMANAKCGEIY--FQSLHSFRIDCAFCEMKSFVFGDFLLHVQNIHFENGLLKTEATDAGA 69

  Fly    86 --WKKIDRRK----PV-----------YEVDEDEEEELELEELLLEPPEMIICDTNLSAQNTPIV 133
              .::.||.:    ||           ||:..|..|:.:.|.::||..:    :.........|:
  Fly    70 NLKQERDREREPNSPVPIVAQVNPFAWYEIGGDHNEDSDDERVVLEKQD----EDEDERPGRSII 130

  Fly   134 AEQAPPTLVFHTFTENVQQPPETEKKALEEPPLTTYKCDLCADEFREEKRLIL---HKKEHQGHM 195
            ..|...:|.    :|:::|     .:||:    ..||.:   |..:||..:.|   .:..|...:
  Fly   131 KWQDHQSLT----SESLRQ-----VRALK----VDYKEE---DSEQEECGMELDLDSEGRHSAKI 179

  Fly   196 LYHCTEPGCEEAFNRFENLRQHEL-EHSE-----------------------VGMRFVCEEEGCN 236
            .:.|  |.|.:.:...:.|.:|.: :|.:                       ....:.||.  |.
  Fly   180 PHSC--PHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYKCEH--CG 240

  Fly   237 RMYRHKASLKYHQSKAHDIGKP--------------------LKTHM--------CEFCGRVFKT 273
            ::|..|.||:.|..:.||.|:.                    |..||        |..|||.:||
  Fly   241 KIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYKT 305

  Fly   274 GSALSQHRFTHGDQLVLPYACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELR 338
            ...|.:|:..|..:..:|  |..|.|..||::...::.|...|...|||.|..||.....|..||
  Fly   306 RHELKRHQLKHTSERNVP--CPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLR 368

  Fly   339 LHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTG 403
            :||..||.||.:.|:.|.|...|.:.|::|: |:|...|.:.||.|...|:......:|:..|..
  Fly   369 VHIRSHTGERPFGCQVCDKRFPSHSGLREHM-AMHSTERPHVCSVCGATFSRQKGLYHHKFLHAD 432

  Fly   404 EKNFECHVCGKKFIQPSALRTHRKVHESGD 433
            .|.|.|.:||..:.|.:.|..|.:.|.:.:
  Fly   433 TKQFVCKLCGNAYAQAAGLAGHMRKHRNDE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 11/51 (22%)
C2H2 Zn finger 171..191 CDD:275368 4/22 (18%)
zf-C2H2_8 199..287 CDD:292531 29/139 (21%)
C2H2 Zn finger 199..221 CDD:275368 5/22 (23%)
C2H2 Zn finger 230..253 CDD:275368 8/22 (36%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 8/19 (42%)
zf-C2H2_8 323..411 CDD:292531 32/90 (36%)
C2H2 Zn finger 327..346 CDD:275368 5/18 (28%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
zf-H2C2_2 367..389 CDD:290200 11/21 (52%)
C2H2 Zn finger 382..402 CDD:275368 7/20 (35%)
zf-H2C2_2 395..419 CDD:290200 9/24 (38%)
C2H2 Zn finger 410..430 CDD:275368 5/19 (26%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.