Sequence 1: | NP_001261477.1 | Gene: | CG10147 / 38733 | FlyBaseID: | FBgn0035702 | Length: | 448 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001129369.1 | Gene: | Zfp707 / 315088 | RGDID: | 1311188 | Length: | 390 | Species: | Rattus norvegicus |
Alignment Length: | 200 | Identity: | 60/200 - (30%) |
---|---|---|---|
Similarity: | 88/200 - (44%) | Gaps: | 11/200 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 EEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEFCGRVFKTGSALSQHRFTH-GDQLVLPYAC 294
Fly 295 ELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVC 359
Fly 360 NSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRT 424
Fly 425 HRKVH 429 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10147 | NP_001261477.1 | zf-AD | 7..80 | CDD:214871 | |
C2H2 Zn finger | 171..191 | CDD:275368 | |||
zf-C2H2_8 | 199..287 | CDD:292531 | 16/56 (29%) | ||
C2H2 Zn finger | 199..221 | CDD:275368 | |||
C2H2 Zn finger | 230..253 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 264..284 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 294..316 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 352..373 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 381..401 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 409..429 | CDD:275368 | 7/19 (37%) | ||
Zfp707 | NP_001129369.1 | KRAB | 40..100 | CDD:214630 | |
KRAB | 40..76 | CDD:279668 | |||
C2H2 Zn finger | 197..217 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 225..245 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 237..261 | CDD:290200 | 8/23 (35%) | ||
COG5048 | <249..385 | CDD:227381 | 36/109 (33%) | ||
C2H2 Zn finger | 253..273 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 266..290 | CDD:290200 | 9/23 (39%) | ||
zf-C2H2 | 279..301 | CDD:278523 | 6/22 (27%) | ||
C2H2 Zn finger | 281..301 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 293..318 | CDD:290200 | 8/25 (32%) | ||
C2H2 Zn finger | 309..329 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 321..344 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 337..357 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 365..385 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |