DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and ZNF707

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001094068.1 Gene:ZNF707 / 286075 HGNCID:27815 Length:371 Species:Homo sapiens


Alignment Length:168 Identity:56/168 - (33%)
Similarity:78/168 - (46%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 MCEFCGRVFKTGSALSQHRFTH-GDQLVLPYACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPY 326
            :|..||:.....|.|..|:..| |.:     |.|.|||...|.....|:.|...|...|.|.|..
Human   177 ICGTCGKALSCHSRLLAHQTVHTGTK-----AFECPECGQTFRWASNLQRHQKNHTREKPFCCEA 236

  Fly   327 CGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYCEKKFATT 391
            ||...:.|:.|..|...||..|.:||.||.|.....::|.:| :.:|...|.:.|:.|.|.|.|.
Human   237 CGQAFSLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKSNLLRH-QLVHTGERPFYCADCGKAFRTK 300

  Fly   392 DTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHRKVH 429
            :...:|:..|:|||.:.|..|||.|..|.....||::|
Human   301 ENLSHHQRVHSGEKPYTCAECGKSFRWPKGFSIHRRLH 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368
zf-C2H2_8 199..287 CDD:292531 8/24 (33%)
C2H2 Zn finger 199..221 CDD:275368
C2H2 Zn finger 230..253 CDD:275368
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
C2H2 Zn finger 294..316 CDD:275368 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
ZNF707NP_001094068.1 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..143
C2H2 Zn finger 178..198 CDD:275368 6/19 (32%)
COG5048 <187..366 CDD:227381 53/158 (34%)
C2H2 Zn finger 206..226 CDD:275368 6/19 (32%)
zf-H2C2_2 218..242 CDD:290200 8/23 (35%)
C2H2 Zn finger 234..254 CDD:275368 6/19 (32%)
zf-C2H2 260..282 CDD:278523 7/22 (32%)
C2H2 Zn finger 262..282 CDD:275368 6/20 (30%)
zf-H2C2_2 274..299 CDD:290200 8/25 (32%)
C2H2 Zn finger 290..310 CDD:275368 6/19 (32%)
zf-H2C2_2 302..325 CDD:290200 9/22 (41%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..366 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.