DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and Zfp212

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_663551.2 Gene:Zfp212 / 232784 MGIID:2682609 Length:492 Species:Mus musculus


Alignment Length:211 Identity:56/211 - (26%)
Similarity:83/211 - (39%) Gaps:52/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 DIGKPLKTH----MCEFCGRVFKTGSALSQHRFTHGDQLVLPYACELPECSMRFYSTEKLKIHMM 314
            |..:..|:|    :.:.||:..|.....|            ||.|  |||.:.|...::|..|:.
Mouse   283 DCPRKQKSHRQVQLGQECGQGLKVKRDSS------------PYKC--PECQISFRYKQQLTAHLQ 333

  Fly   315 RHQGIKNFSC--------PYCGLKKTTKNELRLHINYHTLERTWSCK----------------DC 355
            .|.|.:::|.        |...||...|.. :|| ......|::|||                ..
Mouse   334 SHAGRESYSATEPEESLRPRPRLKPQAKRS-KLH-QCDVCHRSFSCKVSLVTHQRCHQQEGPSTS 396

  Fly   356 PKV-----CNSSTSLKKHIRAIHEKAR-DYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGK 414
            |::     .||..:|..||.  ..|:| ...|.||.|.|:.......|:..||||:.:.|..|.|
Mouse   397 PQIQERFSPNSLVALPGHIP--WRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCPECEK 459

  Fly   415 KFIQPSALRTHRKVHE 430
            .|:|...|..|:|:|:
Mouse   460 SFVQKQHLLQHQKIHQ 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368
zf-C2H2_8 199..287 CDD:292531 7/36 (19%)
C2H2 Zn finger 199..221 CDD:275368
C2H2 Zn finger 230..253 CDD:275368
C2H2 Zn finger 264..284 CDD:275368 4/19 (21%)
C2H2 Zn finger 294..316 CDD:275368 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/27 (22%)
C2H2 Zn finger 352..373 CDD:275368 8/41 (20%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
Zfp212NP_663551.2 KRAB_A-box 142..180 CDD:143639
zf-C2H2 313..335 CDD:278523 8/23 (35%)
C2H2 Zn finger 315..335 CDD:275368 7/21 (33%)
COG5048 <358..>474 CDD:227381 33/119 (28%)
C2H2 Zn finger 368..388 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-C2H2 426..446 CDD:278523 6/19 (32%)
zf-H2C2_2 438..463 CDD:290200 9/24 (38%)
C2H2 Zn finger 454..474 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.