DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and klu-1

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_493611.2 Gene:klu-1 / 173366 WormBaseID:WBGene00013970 Length:543 Species:Caenorhabditis elegans


Alignment Length:397 Identity:79/397 - (19%)
Similarity:129/397 - (32%) Gaps:154/397 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KIDRRKPVYEVDEDEEEELELEELLLEPPEMIICDTNLSAQNTPIVAEQAPPTLVFHTFTENVQQ 152
            ::.|.:...|.|....:|.::..|            |.|..:.||.|::.     .|.|...:  
 Worm   182 ELSRERSRSESDMQPTQEDDVRHL------------NTSTISVPIYAKKP-----LHKFGGEI-- 227

  Fly   153 PPETEKKALEEPPLTTYKCDLCADEFRE--EKRLILH-------KKE------------------ 190
                 |::...||.|       :|| ||  |:||:|.       ||:                  
 Worm   228 -----KRSSSTPPPT-------SDE-REQVEQRLLLRPSSGMEIKKDLETTNSFVSSWAREQIFA 279

  Fly   191 HQGHMLYH---------C---TEPGCEEAFNRFENLRQHELEHSEVGMRFVCEEEGCNRMYRHKA 243
            .|...:|:         |   :.||..:.|.|           |:..|.|...::          
 Worm   280 MQNATMYNLLTARSAEDCSTISTPGPLKVFPR-----------SKDDMTFAPRDD---------- 323

  Fly   244 SLKYHQSKAHDIGKPLKTHMCEFCGRVFKTGSALSQHRFTHGDQLVLPYACELPECSMRFYSTEK 308
                 .|:|..:..|     |..||:.|.....|::|..:...|    .:|.|.:.|        
 Worm   324 -----SSRAKQMQYP-----CTLCGQAFAVHDRLAKHIASRHRQ----RSCTLDDAS-------- 366

  Fly   309 LKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIH 373
             |:|                                      .|..|.|..:.|..|.:|:| :|
 Worm   367 -KVH--------------------------------------KCNMCSKSFSRSDMLTRHMR-LH 391

  Fly   374 EKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHRKVHESGDNQQTA 438
            ..|:.|:|..|.:.|:.:|....|..||||||.:.|.:|.....:...:..|.:.|...|:...:
 Worm   392 TGAKPYSCPTCNQVFSRSDHLSTHLRTHTGEKPYACPMCNYSASRRDMISRHMRTHSLTDDSSIS 456

  Fly   439 CALLQLT 445
            ..:.||:
 Worm   457 TPISQLS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368 10/46 (22%)
zf-C2H2_8 199..287 CDD:292531 17/90 (19%)
C2H2 Zn finger 199..221 CDD:275368 5/24 (21%)
C2H2 Zn finger 230..253 CDD:275368 1/22 (5%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
C2H2 Zn finger 294..316 CDD:275368 5/21 (24%)
C2H2 Zn finger 324..344 CDD:275368 0/19 (0%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 3/19 (16%)
klu-1NP_493611.2 C2H2 Zn finger 334..354 CDD:275368 6/19 (32%)
zf-C2H2 369..391 CDD:278523 8/60 (13%)
C2H2 Zn finger 371..391 CDD:275368 7/20 (35%)
zf-H2C2_2 383..408 CDD:290200 9/25 (36%)
COG5048 395..>448 CDD:227381 15/52 (29%)
C2H2 Zn finger 399..419 CDD:275368 5/19 (26%)
zf-H2C2_2 411..436 CDD:290200 9/24 (38%)
C2H2 Zn finger 427..447 CDD:275368 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.