DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10147 and ZNF524

DIOPT Version :9

Sequence 1:	NP_001261477.1	Gene:	CG10147 / 38733	FlyBaseID:	FBgn0035702	Length:	448	Species:	Drosophila melanogaster
Sequence 2:	XP_011524789.1	Gene:	ZNF524 / 147807	HGNCID:	28322	Length:	370	Species:	Homo sapiens

Alignment Length:	139	Identity:	40/139 - (28%)
Similarity:	52/139 - (37%)	Gaps:	39/139 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   202 PGCEEAFNRFENLRQHELEHSEVGMRFVCEEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEF 266
            |.|..||....:|.:|.:.|||                                   ||.|.|:.
Human   223 PVCLRAFPYLSDLERHSISHSE-----------------------------------LKPHQCKV 252

  Fly   267 CGRVFKTGSALSQHRFTHGDQLVLPYACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKK 331
            ||:.||..|.|.:|...|..  :.|:.|  |.|..||....:|..|...|.|.:.:.||.|.|:.
Human   253 CGKTFKRSSHLRRHCNIHAG--LRPFRC--PLCPRRFREAGELAHHHRVHSGERPYQCPICRLRF 313

  Fly   332 TTKNELRLH 340
            |..|.||.|
Human   314 TEANTLRRH 322

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10147	NP_001261477.1	zf-AD	7..80	CDD:214871
		C2H2 Zn finger	171..191	CDD:275368
		zf-C2H2_8	199..287	CDD:292531	21/84 (25%)
		C2H2 Zn finger	199..221	CDD:275368	6/18 (33%)
		C2H2 Zn finger	230..253	CDD:275368	0/22 (0%)
		C2H2 Zn finger	264..284	CDD:275368	8/19 (42%)
		C2H2 Zn finger	294..316	CDD:275368	7/21 (33%)
		C2H2 Zn finger	324..344	CDD:275368	9/17 (53%)
		C2H2 Zn finger	352..373	CDD:275368
		C2H2 Zn finger	381..401	CDD:275368
		C2H2 Zn finger	409..429	CDD:275368
ZNF524	XP_011524789.1	COG5048	<219..>283	CDD:227381	25/98 (26%)
		C2H2 Zn finger	222..242	CDD:275368	6/18 (33%)
		zf-H2C2_2	234..259	CDD:290200	12/59 (20%)
		C2H2 Zn finger	250..270	CDD:275368	8/19 (42%)
		zf-H2C2_2	262..285	CDD:290200	7/26 (27%)
		C2H2 Zn finger	278..298	CDD:275368	7/21 (33%)
		zf-H2C2_2	290..314	CDD:290200	8/23 (35%)
		C2H2 Zn finger	306..327	CDD:275368	9/17 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100