DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10147 and znf1137

DIOPT Version :9

Sequence 1:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001103309.1 Gene:znf1137 / 100126111 ZFINID:ZDB-GENE-071004-87 Length:293 Species:Danio rerio


Alignment Length:330 Identity:81/330 - (24%)
Similarity:128/330 - (38%) Gaps:54/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 EEEELELEELLLEPPEMIICDTNLSAQNTPIVAEQAPPTLVFHTF--TENVQQPPETEKKALEEP 164
            |.|::::||......|.:...|.:..:|...:.|:....:...||  |:.:          |:..
Zfish     7 ESEDVKIEETFTVKQEDLQEQTEIIEENERSIEEEHHVKIEEKTFLQTDGI----------LKRR 61

  Fly   165 PLTTYKCDLCADEFREEKRLILHKKEHQGHMLYHCTEPGCEEAFNRFENLRQHELEHSEVGMRFV 229
            ....:.|..|...|..:..|.:|...|.|...:.||:                            
Zfish    62 GKNRFTCTQCGKSFGRKDILKIHMMIHTGEKPFTCTQ---------------------------- 98

  Fly   230 CEEEGCNRMYRHKASLKYHQSKAHDIGKPLKTHMCEFCGRVFKTGSALSQHRFTHGDQLVLPYAC 294
                 |.:.:....|...|. :.|...||.   .|..||:.|....:.:.|...|..:  .|:.|
Zfish    99 -----CGKSFSLSWSRNLHM-RIHSGEKPF---TCTQCGKSFSLSWSRNLHMRIHSGE--KPFTC 152

  Fly   295 ELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVC 359
              .:|...|.|:.....||..|.|.|.|:|..||...:..:.|..|:..||.|:.::|..|.|..
Zfish   153 --TQCWKSFSSSSHFNYHMRVHTGEKPFTCTQCGKSFSCSSSLNQHMRIHTGEKPFTCTQCGKSF 215

  Fly   360 NSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRT 424
            :.|:.|..|:| ||...:.:.|:.|.|.|:.:....:|...|||||.|.|..|||.|.:.|.|..
Zfish   216 SQSSHLNHHMR-IHTGEKPFTCTQCGKSFSQSSHLNHHMRIHTGEKPFTCTQCGKSFSRSSHLNQ 279

  Fly   425 HRKVH 429
            |.::|
Zfish   280 HMRIH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)
zf-C2H2_8 199..287 CDD:292531 14/87 (16%)
C2H2 Zn finger 199..221 CDD:275368 2/21 (10%)
C2H2 Zn finger 230..253 CDD:275368 3/22 (14%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
znf1137NP_001103309.1 C2H2 Zn finger 68..88 CDD:275368 5/19 (26%)
zf-H2C2_2 81..104 CDD:290200 7/55 (13%)
C2H2 Zn finger 96..116 CDD:275368 5/53 (9%)
zf-H2C2_2 112..132 CDD:290200 7/23 (30%)
C2H2 Zn finger 124..144 CDD:275368 5/19 (26%)
COG5048 <136..>292 CDD:227381 50/154 (32%)
zf-H2C2_2 140..161 CDD:290200 6/24 (25%)
C2H2 Zn finger 152..172 CDD:275368 6/21 (29%)
zf-H2C2_2 164..189 CDD:290200 9/24 (38%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 192..217 CDD:290200 8/24 (33%)
C2H2 Zn finger 208..228 CDD:275368 7/20 (35%)
zf-H2C2_2 220..245 CDD:290200 9/25 (36%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 248..273 CDD:290200 12/24 (50%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12262
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.