DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13300 and CG42747

DIOPT Version :9

Sequence 1:NP_648043.1 Gene:CG13300 / 38730 FlyBaseID:FBgn0035699 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_648045.2 Gene:CG42747 / 38732 FlyBaseID:FBgn0261801 Length:404 Species:Drosophila melanogaster


Alignment Length:384 Identity:126/384 - (32%)
Similarity:175/384 - (45%) Gaps:99/384 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VNQVASVSVSISASASALPSVSA------SEFPTFSPPRIASLVASSSAEDLSSFGDVTFDIFDD 77
            :.|.||.::......|.|.|::.      |:.|  .||...::..:||         :.::..:|
  Fly     4 IYQDASTTLRSVFPNSRLDSLAGVDRRMESQLP--GPPDADAVTTASS---------IGYNPLND 57

  Fly    78 DD--------DLFGSPMAFDASEQGLWNGRFVPPPPRPPFFVDEPVLSDGLTTCDLCSWAMPTKS 134
            ||        |.|.||:||||||.|||||.||||||||| |:||.|.:|||||||||:||. .::
  Fly    58 DDWWANAIEVDTFDSPLAFDASENGLWNGHFVPPPPRPP-FLDESVAADGLTTCDLCTWAW-QRN 120

  Fly   135 TFMFEGTIEKATELGWPLTLIIVSVLSALLGAIIMIAVVRCRRKKSSNNRNDTHVQWWSRNKRAH 199
            .:..:|:||.|.||||..||||||::|||:|||:|:.|:||||.||:|........||.||.|  
  Fly   121 AYSLDGSIETAGELGWAFTLIIVSIISALIGAIVMVIVLRCRRIKSANANGGRPQPWWCRNNR-- 183

  Fly   200 GNGLNGAGGASGAAGGAGGNVHHHNGSSSNINNNHLRRSNIYTAHPADSIRGLQPLPVVLPLPLS 264
                                    ||..:        ||.|...|.|||||              
  Fly   184 ------------------------NGGQN--------RSPISIKHSADSIR-------------- 202

  Fly   265 LPHPPSG-----GASPASSS--------TTPPATQQQQH-----QPLQQQQYFHPYQQQQHVHHS 311
            .|...||     |.|..||:        :|.||.....|     .|:...:..:....::.|..:
  Fly   203 RPTSNSGVWTWLGGSRRSSAGPDQIGPPSTSPAENHYTHMDDAYSPVGVSEALYAELDRESVRSA 267

  Fly   312 HTHHHHTHHHVPLYPHDCDEDAAYEEPEYHQPQQLHSVNSSSSLSSMGSSSLPQEASNS 370
            :..:.:|.:      ..|.|...|:..|...|..:.|..||:..|.:..:::|..||.|
  Fly   268 NPSYQNTAY------SQCGEKYNYQGHEQDIPMVVSSAPSSAYYSDLSVTAMPGGASGS 320



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCMD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016786
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.