DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and LIPG

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_005258447.1 Gene:LIPG / 9388 HGNCID:6623 Length:536 Species:Homo sapiens


Alignment Length:326 Identity:86/326 - (26%)
Similarity:141/326 - (43%) Gaps:59/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 INPSDARLHVMTITNQSVE---LPIKSISQIKDFDINPERKTLIYVNAFHTADSYFSVQEH--LT 136
            :.|| .|.::.|..:...|   |.:.....::|...|...||...::.: |....|....|  ::
Human    81 VKPS-VRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGW-TMSGIFENWLHKLVS 143

  Fly   137 LLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRALKDA-GIAVQDITLAGHSVGA 200
            .|....:|.||:|||:.....|||....::..|.|:.:.::|..|::. ..::.::.|.|:|:||
Human   144 ALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGA 208

  Fly   201 NIAALGAQLFAKENKQLVGQLLAIDPA-TMCRTTDILVKQSV--ALRVVVLH----GEGDVFGVR 258
            ::|.......    |..||::..:||| .|....||..:.|.  |..|.|||    ..|...|::
Human   209 HVAGYAGNFV----KGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQ 269

  Fly   259 VPLGHIDIYPNGIGYFPRRKLQPGC---------------ESKICSHMYPFILFMEALI-EGVMI 307
            :|:||||||||| |.|     ||||               |...|.|.....||:::|: :....
Human   270 MPVGHIDIYPNG-GDF-----QPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPS 328

  Fly   308 PATKCESWAKFRQGDC-----NFQNTINIGLIYPANAKGL-------YFCMTQPNPPFTYMEHGL 360
            .|.:|....:|::|.|     |..|:|..      |||.:       .:..|:...||....:.:
Human   329 FAFQCTDSNRFKKGICLSCRKNRCNSIGY------NAKKMRNKRNSKMYLKTRAGMPFRVYHYQM 387

  Fly   361 R 361
            :
Human   388 K 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 80/298 (27%)
LIPGXP_005258447.1 Pancreat_lipase_like 85..376 CDD:238363 82/307 (27%)
lipo_lipase 86..521 CDD:132274 84/320 (26%)
PLAT_LPL 383..519 CDD:238856 0/6 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.