DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and NSE5

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_013689.1 Gene:NSE5 / 854985 SGDID:S000004485 Length:556 Species:Saccharomyces cerevisiae


Alignment Length:355 Identity:68/355 - (19%)
Similarity:127/355 - (35%) Gaps:118/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAQFTMQKSTAQM---IIAVCLICQSLAVEDKD---KATNPLNI--DSVQKHNVKLLSEQLNRG 57
            :..||....:.|.:   ||.|.....:|:...|:   :|.:|.|.  :::.:..:|||.:.|   
Yeast    51 LECQFGKSHNLAVIPFDIILVLFTLSTLSEYYKEPILRANDPYNTSRETLSRRALKLLQKYL--- 112

  Fly    58 WRAFCDAPVDEGVMSLFQGINPSDARLHVMTITNQSVELPIKSISQIKD---FD----------- 108
                          ::.:..:.....|:.:.:......|.|.:::..|.   ||           
Yeast   113 --------------AILKEFDSEQYNLYDLELLRCQFFLAIDTLTPKKQKWGFDRFRRTKSESGV 163

  Fly   109 -------INPE---RKTLIYVNAFHTADSYFS-VQEHLTLLQNSRRDLNVIVVDFAKDVAQLYYA 162
                   ::||   .||  :.|.:.   ||.| :::..|:|.|  |.||:.:.:..:.:..:.:.
Yeast   164 TYRQNASVDPELDQAKT--FKNPYR---SYISCLEQRNTILGN--RLLNLKLNEPGEFINMILWT 221

  Fly   163 VRHHLS------VNGYFVY-KLLRALKDAGIAVQDITLAGHSVGANIA----------------- 203
            :.:.|.      ::.:.:: .||..|.|.....||..:. |.|..|::                 
Yeast   222 LSNSLQESTPLFLSSHEIWMPLLEILIDLFSCRQDYFIQ-HEVAQNVSKSLFVQRLSESPLAVFF 285

  Fly   204 -ALGAQLFAKENKQLV----------------------GQLLAID---PATMCRTTDILVK--QS 240
             :|..:.||....:.|                      |:...:|   |...|..   |.|  :|
Yeast   286 ESLNTRNFANRFSEYVFLNCDYKLPSDNYATPVHPVYNGENTIVDTYIPTIKCSP---LYKSQKS 347

  Fly   241 VALRVVVLHGEGDVFG--VRVPLGHIDIYP 268
            :|||..::   |..|.  :|||.||..|.|
Yeast   348 LALRRKLI---GSCFKLLLRVPDGHRLITP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 52/257 (20%)
NSE5NP_013689.1 Nse5 1..517 CDD:370066 68/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.845196 Normalized mean entropy S242
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.