DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and Pnlip

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus


Alignment Length:351 Identity:76/351 - (21%)
Similarity:135/351 - (38%) Gaps:84/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WRAFCDAPVDEGVMSLFQGINPSDARLHVMTITNQ---SVELPIKSISQIKDFDINPERKTLIYV 119
            |....|.|:.....|      |:......:..||:   :.:|.....|.|::.:....|||.|.:
Mouse    33 WSGTLDRPLKALPWS------PAQINTRFLLYTNENPDNYQLITSDASNIRNSNFRTNRKTRIII 91

  Fly   120 NAF--HTADSYFSVQEHLTLLQNSRR--DLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRA 180
            :.|  ...:::.|     .:.:|..|  .:|.|.||:.......|.....::.|.|..|..|:..
Mouse    92 HGFIDKGEENWLS-----DMCKNMFRVESVNCICVDWKGGSRTTYTQATQNVRVVGAEVALLVNV 151

  Fly   181 LK-DAGIAVQDITLAGHSVGANIAA-LGAQLFAKENKQLVGQLLAIDPAT---MCRTTDILVKQS 240
            |: |.|.::.::.|.|||:|::||. .|.:.|.     .:|::..:|||.   .....::.:..:
Mouse   152 LQSDLGYSLNNVHLIGHSLGSHIAGEAGKRTFG-----AIGRITGLDPAEPYFQGTPEEVRLDPT 211

  Fly   241 VALRVVVLHGE-GDV-----FGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKI------------ 287
            .|..|..:|.: |.:     ||:...:||:|.:||| |.     ..|||:..|            
Mouse   212 DAQFVDAIHTDAGPIIPNLGFGMSQTVGHLDFFPNG-GI-----EMPGCQKNILSQIVDIDGIWE 270

  Fly   288 -------CSHMYPFILFMEALIEGVMIPATKCESWAKFRQGDCNFQNTINIGLIYPANAKGLYFC 345
                   |:|:..:..:.::::.........|.|::.|....|           :|..:.|   |
Mouse   271 GTRNFAACNHLRSYKFYTDSIVNPTGFAGFSCSSYSLFTANKC-----------FPCGSGG---C 321

  Fly   346 MTQPNPPFTYMEHGLRYKARRPEKSS 371
                    ..|.|   |..|.|.|:|
Mouse   322 --------PQMGH---YADRYPGKTS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 63/294 (21%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 76/351 (22%)
Pancreat_lipase_like 51..348 CDD:238363 71/327 (22%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835306
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.