DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and Liph

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_038944552.1 Gene:Liph / 681694 RGDID:1592849 Length:476 Species:Rattus norvegicus


Alignment Length:308 Identity:83/308 - (26%)
Similarity:132/308 - (42%) Gaps:48/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PSDARL--HVMTI-TNQSVELPI-----KSISQIKDF----DINPERKTLIYVNAFHTADSYFSV 131
            ||..||  |...: |..||.|.:     ::.:|:.:.    .:|..:||...::.|....|....
  Rat    60 PSFTRLSFHSAVVGTGLSVRLMLYTQRDQTCAQVINSTALGSLNVTKKTTFIIHGFRPTGSPPVW 124

  Fly   132 QEHLTLLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRALKD----AGIAVQDIT 192
            .|.|.....|.:::||:|||:.:....:.|.   |.|.....|..:|:...|    .|.::.:|.
  Rat   125 MEELVQSLISVQEMNVVVVDWNRGATTVIYP---HASSKTRKVALILKEFIDQMLAKGASLDNIY 186

  Fly   193 LAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPATMC---RTTDILVKQSVALRVVVLHGEGDV 254
            :.|.|:||:||....::::.:    :|::..:|||...   |..:..:..|.|..|.|:|.:.|.
  Rat   187 MIGVSLGAHIAGFVGEMYSGK----LGRITGLDPAGPLFNGRPPEDRLDPSDAQFVDVIHSDTDA 247

  Fly   255 FGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKI--------CSHMYPFILFMEALIEGVMIPATK 311
            .|.|..|||||.|||| |..     ||||...|        |.|.....|::.:|.....|.|..
  Rat   248 LGYREALGHIDFYPNG-GLD-----QPGCPKTIFGGIKYFKCDHQMSVFLYLASLQNNCSITAYP 306

  Fly   312 CESWAKFRQGDCNFQNTINIGLIYPANAKGLYF-----CMTQPNPPFT 354
            |:|:..:|.|.|   .:...|.|....:.|.|.     .:...:||.|
  Rat   307 CDSYRDYRNGKC---VSCGAGHIVSCPSLGYYADNWREYLWDRDPPMT 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 74/286 (26%)
LiphXP_038944552.1 Pancreat_lipase_like 78..347 CDD:238363 73/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.