DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:361 Identity:78/361 - (21%)
Similarity:136/361 - (37%) Gaps:108/361 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LFQGINPSDARLHVMTITNQSVELPIKSISQIKDFDINPERKTLIYVNAF--HTADSY------- 128
            |:...||::.:|    ||....:       .|:..:...:|||...::.|  ...||:       
Human    58 LYTNENPNNFQL----ITGTEPD-------TIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKK 111

  Fly   129 -FSVQEHLTLLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRALK-DAGIAVQDI 191
             |.|::           :|.|.||:......:|.....::.|.|.....|::||. ..|.:::|:
Human   112 MFEVEK-----------VNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDV 165

  Fly   192 TLAGHSVGANIAA-LGAQLFAKENKQLVGQLLAIDPATMC---RTTDILVKQSVALRVVVLHGEG 252
            .:.|||:||:.|| .|.:|..:     ||::..:|||..|   ...::.:..|.|:.|.|:|.:.
Human   166 HVIGHSLGAHTAAEAGRRLGGR-----VGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDS 225

  Fly   253 DV------FGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKI-------------------CSHMY 292
            ..      ||:...:||:|.:|||      .|..|||:..:                   |:|:.
Human   226 SPIVPSLGFGMSQKVGHLDFFPNG------GKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLR 284

  Fly   293 PFILFMEALIEGVMIPATKCESWAKFRQGDCNFQNTINIGLIYPANAKG---------------- 341
            .|..:..:::.........|.|:.:|::..|           :|..|:|                
Human   285 SFEYYSSSVLNPDGFLGYPCASYDEFQESKC-----------FPCPAEGCPKMGHYADQFKGKTS 338

  Fly   342 ----LYFCMTQPNPPFTYMEHGLRYKARRPEKSSEK 373
                .:|..|..:..||    ..|||........||
Human   339 AVEQTFFLNTGESGNFT----SWRYKVSVTLSGKEK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 65/317 (21%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 71/339 (21%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 3/11 (27%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 0/21 (0%)
PLAT_PL 357..469 CDD:238857 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.