DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and PLA1A

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens


Alignment Length:347 Identity:87/347 - (25%)
Similarity:149/347 - (42%) Gaps:79/347 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DAP-------VDEGVMSLFQGINPSDARLHVMTI--TNQSVELPIKSISQIKDFDINPERKTLIY 118
            |||       .|....:||:|   :|.::..:..  :|.|....::..|.:::...|....|.:.
Human    26 DAPPTPQPKCADFQSANLFEG---TDLKVQFLLFVPSNPSCGQLVEGSSDLQNSGFNATLGTKLI 87

  Fly   119 VNAFHT-------ADSYFSVQEHLTLLQNSRRDLNVIVVDFAKDVAQLYY-AVRHHLSVN---GY 172
            ::.|..       .|::..     |||:.:  :.|||.||:......:|: ||::.:.::   ..
Human    88 IHGFRVLGTKPSWIDTFIR-----TLLRAT--NANVIAVDWIYGSTGVYFSAVKNVIKLSLEISL 145

  Fly   173 FVYKLLRALKDAGIAVQDITLAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPATMCRTTDILV 237
            |:.|||    ..|::...|.:.|.|:||::..:..|||..:    :||:..:|||.. ..|...|
Human   146 FLNKLL----VLGVSESSIHIIGVSLGAHVGGMVGQLFGGQ----LGQITGLDPAGP-EYTRASV 201

  Fly   238 KQSV----ALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCES--------KICSH 290
            ::.:    ||.|..:|.:.|..|:|:|:||:|.:.||      .:.||||.:        .||.|
Human   202 EERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNG------GQDQPGCPTFFYAGYSYLICDH 260

  Fly   291 MYPFILFMEALIEGVMIPATKCESWAKFRQGDCNFQNTIN--------IGLI---------YPAN 338
            |....|::.||.....:.|..|.|:..|..|.|  .:..|        |||:         .|..
Human   261 MRAVHLYISALENSCPLMAFPCASYKAFLAGRC--LDCFNPFLLSCPRIGLVEQGGVKIEPLPKE 323

  Fly   339 AKGLYFCMTQPNPPFTYMEHGL 360
            .|  .:.:|..:.|:. |.|.|
Human   324 VK--VYLLTTSSAPYC-MHHSL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 75/297 (25%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 83/338 (25%)
Pancreat_lipase_like 49..332 CDD:238363 75/308 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.