DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and lipia

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:269 Identity:78/269 - (28%)
Similarity:116/269 - (43%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LFQGINPSDARL--HVMTITNQSVELPIKSISQIKDFDINPERKT---LIYVNAFHTADSYFSVQ 132
            |:...:||..:|  |....:|...     ::|.:..|.|:..|.|   .:::..|          
Zfish    49 LYTRADPSCGQLLSHQEPFSNSQF-----NVSSVTTFLIHGYRPTGSPPVWMKQF---------- 98

  Fly   133 EHLTLLQNSRRDLNVIVVDFAKDVAQLYY--AVRHHLSVNGYFVYKLLRALKDAGIAVQDITLAG 195
              :..|.| |||:||||||:.:....:.|  .|::...|..... .|::.:||.|..:..|.:.|
Zfish    99 --VEFLLN-RRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLT-DLIQKMKDNGANLSSIHMIG 159

  Fly   196 HSVGANIAALGAQLFAKENKQLVGQLLAIDPA---TMCRTTDILVKQSVALRVVVLHGEGDVFGV 257
            .|:||:|:......|..|    :|::.|:|||   ...|..:..:..|.||.|..||.:.|..|.
Zfish   160 VSLGAHISGFTGANFNGE----IGRITALDPAGPEFNGRPPEDRLDPSDALFVEALHTDMDALGY 220

  Fly   258 RVPLGHIDIYPNGIGYFPRRKLQPGCESKI--------CSHMYPFILFMEALIEGVMIPATKCES 314
            |..|||||.|.||      ...||||...|        |.|.....|:|.::.....|.|..|||
Zfish   221 RNLLGHIDYYANG------GADQPGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPCES 279

  Fly   315 WAKFRQGDC 323
            :..|:.|.|
Zfish   280 YTDFQDGTC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 73/249 (29%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 78/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.