DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and CG17192

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster


Alignment Length:362 Identity:84/362 - (23%)
Similarity:139/362 - (38%) Gaps:89/362 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NVKLLSEQLN--RGWRAFCDAPVDEGVMSLFQGINPSDARLHVMTITNQSVELPIKSISQIKDFD 108
            |...:.|::|  .||    ..|.::|.   ||.::..||:..:..|:      |::..|....|.
  Fly    15 NALPIEERINGENGW----FVPQEDGT---FQWMDKKDAKELLENIS------PLEFRSNEVSFY 66

  Fly   109 I----NPERKTLIYVNAFHTADSYF-------------------SVQEHLTLLQNSRRDLNVIVV 150
            :    ||.....|..:|.....|:|                   |:...:|....|:.|.|||||
  Fly    67 LYTKQNPTEGQEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGDFNVIVV 131

  Fly   151 DFAKDVAQLYYAVRHHLSVNGYFVYKLLRALKDAG---------------IAVQDITLAGHSVGA 200
            ::|:.     .:|.:.:||         ||:..||               ::::.:.:.|||:||
  Fly   132 NWARS-----QSVDYAMSV---------RAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGA 182

  Fly   201 NIAA-LGAQLFAKENKQLVGQLLAIDPAT---MCRTTDILVKQSVALRVVVLHGEGDVFGVRVPL 261
            ::|. .|.|:..|....:||    :|||.   .....|..:....|..|..:...|.|.|...|:
  Fly   183 HVAGYAGKQVGQKRVHTIVG----LDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPI 243

  Fly   262 GHIDIYPNGIGYFPRRKLQPGCESKI---CSHMYPFILFMEALIEGVMIPATKCESWAKFRQGDC 323
            |....|.:|     .|| ||||...:   |||....|.:.||:.|. ...|.:|:.:......:|
  Fly   244 GKAAFYVSG-----GRK-QPGCGVDLAGTCSHARSVIYYAEAITEN-SFGAIQCQDYQAALDNEC 301

  Fly   324 NFQNTINIGLIYPANA---KGLYFCMTQPNPPFTYME 357
            . .:..::.:....||   :|.::.......||...|
  Fly   302 G-SSFSSVRMAEDTNAYNVEGHFYVPVNSEAPFGQTE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 69/305 (23%)
CG17192NP_651522.1 Lipase 55..333 CDD:278576 69/303 (23%)
Pancreat_lipase_like 62..329 CDD:238363 67/292 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445913
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.