DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and CG6295

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:385 Identity:82/385 - (21%)
Similarity:152/385 - (39%) Gaps:101/385 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MIIAVCLICQSLAVEDKDKATNPLNIDSVQKHNVKLLSEQLNRGW-------------RAFCDAP 65
            :.:|.|::..: |||.:....|                     ||             |.|.:|.
  Fly     6 LALAFCVLAAN-AVEVRVNGEN---------------------GWYVPQADGTMEWMDREFAEAY 48

  Fly    66 VDEGVMSLFQG---INPSDARLHVMTITNQSVELPIKSIS-QIKDFDINPERKTLIYVNAFHTA- 125
            ::  ..:..:|   :||  ...::.|.:|::....||:.| .|.....||...|...::.:.:: 
  Fly    49 LE--TKNRMEGRNVLNP--VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSK 109

  Fly   126 ---------DSYFSVQEHLTLLQNSRRDLNVIVVDFAK----DVAQLYYAVRHHLSVNGYFVYKL 177
                     |::|           :..|:|:|.||:.:    |.|....||    ...|..|..|
  Fly   110 DEFINYGVRDAWF-----------THGDMNMIAVDWGRARSVDYASSVLAV----PGVGEQVATL 159

  Fly   178 LRALK-DAGIAVQDITLAGHSVGANIAALGAQLFAKENKQLVGQL---LAIDPATMCRTTDILVK 238
            :..:: :.|:.:.:..:.|||:||:::.     :|.:|.: .|||   :.:|||....:.|...|
  Fly   160 INFMRSNHGLNLDNTMVIGHSLGAHVSG-----YAGKNVK-NGQLHTIIGLDPALPLFSYDSPNK 218

  Fly   239 Q---SVALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKI---CSHMYPFILF 297
            :   :.|..|..:...|...|...|:|....||||      .|.||||...:   |:|....|.:
  Fly   219 RLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNG------GKSQPGCGVDLTGSCAHSRSVIYY 277

  Fly   298 MEALIEGVMIPATKCESWAKFRQGDC-NFQNTINIGLIYPANA---KGLYFCMTQPNPPF 353
            .|::.|. ..|..:|..:.:....:| :..:::.:|.  ..||   .|.|:...:.:.|:
  Fly   278 AESVTEN-NFPTMRCGDYEEAVAKECGSSYSSVRMGA--TTNAYMVAGDYYVPVRSDAPY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 66/286 (23%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 67/295 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.