DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and LIPC

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:349 Identity:79/349 - (22%)
Similarity:133/349 - (38%) Gaps:83/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 APVDEGVMSLFQGINPSDARLHVMTI-------TNQSVELPIKSISQIKDFDINPERKTLIYVNA 121
            |||.|...........::..||.|..       |||..::.|.....:::...|.....::.::.
Human    37 APVSEEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRINHPDTLQECGFNSSLPLVMIIHG 101

  Fly   122 FHTADSYFSVQEH------LTLLQNSRRDLNVIVVDFAKDVAQLYY--AVRHHLSVNGYFVYKLL 178
            :    |...|.|:      ..|.....:.:||.:||:. .:|..:|  |||:...| |..|..||
Human   102 W----SVDGVLENWIWQMVAALKSQPAQPVNVGLVDWI-TLAHDHYTIAVRNTRLV-GKEVAALL 160

  Fly   179 RALKDA-GIAVQDITLAGHSVGANIAALGAQLFAKENKQLVGQLLAID----------PATMCRT 232
            |.|::: .::...:.|.|:|:||:::..........:|  :|::..:|          |:.....
Human   161 RWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHK--IGRITGLDAAGPLFEGSAPSNRLSP 223

  Fly   233 TD--------ILVKQSVALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGC------ 283
            .|        ...::.:.|.|          |::.|:||.|.|||| |.|     ||||      
Human   224 DDANFVDAIHTFTREHMGLSV----------GIKQPIGHYDFYPNG-GSF-----QPGCHFLELY 272

  Fly   284 ------------ESKICSHMYPFILFMEALIE-GVMIPATKCESWAKFRQGDC-----NFQNTIN 330
                        ::..|||.....||:::|:. |....|..|.....|.||.|     ...||:.
Human   273 RHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSCKKGRCNTLG 337

  Fly   331 IGLIY-PANAKGLYFCMTQPNPPF 353
            ..:.. |.:.....|.:|:...||
Human   338 YHVRQEPRSKSKRLFLVTRAQSPF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 69/309 (22%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.