DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and CG10357

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:351 Identity:92/351 - (26%)
Similarity:144/351 - (41%) Gaps:99/351 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AFCDAPVDEGVMSLFQGINPS--DARLHVMTI--TNQSVELPIKSISQIKDFD------------ 108
            :.|..|    ::..|.|::.:  |:.|:..||  ...|.::.::::.|:...:            
  Fly     5 SLCLVP----ILCQFLGLHAALLDSLLNQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGS 65

  Fly   109 -----INPERKTLIYVNAFHTADSYFSVQEHLTLLQNSRRDLNVIVVDFAKDVAQLYY-----AV 163
                 |.|.|      ||: ||..|                .||:|.|:. .||.|.|     ||
  Fly    66 CTHGSIMPLR------NAY-TAQGY----------------ENVLVADWG-PVANLDYPSSRLAV 106

  Fly   164 RHHLSVNGYFVYKLLRA-LKDAGIAVQDITLAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPA 227
            ::...:    :.|||.. |:..||:::.:.:.|||:||:||....:.|   |..| |::..:|||
  Fly   107 KNVAQI----LAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF---NGSL-GRVTGLDPA 163

  Fly   228 T---MCRTTDILVKQSVALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCE----- 284
            .   ..|:.|.| ..:.|..|.|:|.:..:||...|.|.:|.||| .|..|    |||||     
  Fly   164 LPLFSSRSDDSL-HSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPN-FGLAP----QPGCENVDVV 222

  Fly   285 --SKI------CSHMYPFILFMEALIEGVMIPATKCESWA--KFRQGDC-------NFQN----- 327
              ||:      |||....:.:.|::......||..|...|  ..|..||       |.:|     
  Fly   223 AASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQ 287

  Fly   328 TINIGLIYPANAKGLYFCMTQPNPPF 353
            |:.:|.....:|...|:..|...||:
  Fly   288 TVFMGEHVNRSATLYYYLETNGAPPY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 82/310 (26%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 83/317 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.