DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and CG6472

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:304 Identity:80/304 - (26%)
Similarity:135/304 - (44%) Gaps:53/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NQSVELPIKSISQIKDFDINPERKTLIYVNAFHTADSYFSVQEHLTLLQNS---RRDLNVIVVDF 152
            |.:..|.:...:::...:.|......||::.|  ::|....::....|:::   |.:.|||::|:
  Fly    55 NSAQLLHLSDDARLAQSNFNFNYPLAIYLHGF--SESATGERQSSQELKDAFLRRGNYNVILIDW 117

  Fly   153 AKDVAQLYYA-VRHHLSVNGYFVYKLLRALKDAGIAVQDITLAGHSVGANIAALGAQLFAKENKQ 216
            :...|..:|: ...:|.|:|.::.:.||.|.|.|...:.|.|.|.|:||.:|.     ||.:..|
  Fly   118 SAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLIGFSLGAEVAG-----FAGKQLQ 177

  Fly   217 LVG----QLLAIDPATMC---RTTDILVKQSVALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYF 274
            ..|    ::.|:|||...   .:::..:..|.|..|.|:|.:|.:.|...|:||.|.||||    
  Fly   178 EWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNG---- 238

  Fly   275 PRRKLQPGCESKI-----------CSHMYPFILFMEALIEGVMIPATKCESWAKFRQGDCN---- 324
             .|.|||||..:.           |||...:..|:|::.:....||.:||....|  |.|.    
  Fly   239 -GRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMF--GICREPGG 300

  Fly   325 ---FQNTINIGLIYPANAKGLYFCMTQPNPPFTYMEHGLRYKAR 365
               |     :|:......:|.::..|....||     |...:||
  Fly   301 GPAF-----MGMGADPRIRGKFYLDTNDAKPF-----GRNSRAR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 75/286 (26%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 75/286 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.