DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and CG6675

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:336 Identity:85/336 - (25%)
Similarity:137/336 - (40%) Gaps:51/336 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KHNV-----KLLSEQLNRGWRAFCDAPVDEGVMSLFQGINPSDARLHVMTITNQSVELPIKSISQ 103
            ||.|     |.|||  :||...|.|.|..:.:.|..........|:|......:..|..      
  Fly    75 KHCVWNTCDKDLSE--SRGIGKFLDLPFIKKIASNLNPFGSKKLRMHFYLFKREFPECG------ 131

  Fly   104 IKDFDINPERK-----------TLIYVNAFHTADSYFSVQEHLTLLQNSRRDLNVIVVDFAKDVA 157
             ::.|.:.|||           |.:.::.: .:.|..|....:......:.:.||||||::...|
  Fly   132 -REVDFSIERKWRHCGFNASLPTRLMIHGW-MSQSRGSFNRDVKNAYLKKGEYNVIVVDWSASSA 194

  Fly   158 QL-YYAVRHHLSVNGYFVYKLLRAL-KDAGIAVQDITLAGHSVGANIA-ALGAQLFAKENKQLVG 219
            .: |::|...:...|..:.:.:|.| :..|.....:.|.|||:||.|| :.|.:|  |..|  |.
  Fly   195 NINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRL--KPVK--VN 255

  Fly   220 QLLAIDPA---TMCRTTDILVKQSVALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQP 281
            .:.|:|||   ...|.|:..:..|.|..|..:|...: ||.|.|.|....|||...|      |.
  Fly   256 TIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSAN-FGFRRPTGSATFYPNYGAY------QH 313

  Fly   282 GCESKICSHMYPFILFMEALIEGVMIPATKC----ESWAKFRQGDCNFQNTINIGLIYPANAKGL 342
            .|....|||:..:.:|.|::...:....|.|    ..|    |.|.:.:.:|.:......:.:|:
  Fly   314 SCYYLGCSHIRSYQMFAESINSPLGFWGTPCIRDNGRW----QCDYSQRQSIQMAGEPSIHKEGI 374

  Fly   343 YFCMTQPNPPF 353
            ::..|..:.||
  Fly   375 FYVKTSSSDPF 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 68/278 (24%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 70/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.